Recombinant Human GAB1 protein, His-tagged
Cat.No. : | GAB1-3130H |
Product Overview : | Recombinant Human GAB1 protein(501-724 aa), fused to His tag, was expressed in E. coli. |
Availability | September 08, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 501-724 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | PKTPPRRPVPVADCEPPPVDRNLKPDRKGQSPKILRLKPHGLERTDSQTIGDFATRRKVKPAPLEIKPLPEWEELQAPVRSPITRSFARDSSRFPMSPRPDSVHSTTSSSDSHDSEENYVPMNPNLSSEDPNLFGSNSLDGGSSPMIKPKGDKQVEYLDLDLDSGKSTPPRKQKSSGSGSSVADERVDYVVVDQQKTLALKSTREAWTDGRQSTESETPAKSVK |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | GAB1 GRB2-associated binding protein 1 [ Homo sapiens ] |
Official Symbol | GAB1 |
Synonyms | GAB1; GRB2-associated binding protein 1; GRB2-associated-binding protein 1; GRB2-associated binder 1; growth factor receptor bound protein 2-associated protein 1; |
Gene ID | 2549 |
mRNA Refseq | NM_002039 |
Protein Refseq | NP_002030 |
MIM | 604439 |
UniProt ID | Q13480 |
◆ Recombinant Proteins | ||
GAB1-1786H | Recombinant Human GAB1 protein, His & T7-tagged | +Inquiry |
GAB1-22H | Recombinant Human GAB1 Protein, T7/His-tagged | +Inquiry |
GAB1-3040H | Recombinant Human GAB1 Protein (Asn394-Arg656), N-His tagged | +Inquiry |
GAB1-12537Z | Recombinant Zebrafish GAB1 | +Inquiry |
GAB1-3130H | Recombinant Human GAB1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GAB1-6076HCL | Recombinant Human GAB1 293 Cell Lysate | +Inquiry |
GAB1-6075HCL | Recombinant Human GAB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GAB1 Products
Required fields are marked with *
My Review for All GAB1 Products
Required fields are marked with *