Recombinant Human GABRB1 Protein, GST-tagged
Cat.No. : | GABRB1-4645H |
Product Overview : | Human GABRB1 partial ORF ( NP_000803, 28 a.a. - 136 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes GABA A receptor, beta 1 subunit. It is mapped to chromosome 4p12 in a cluster comprised of genes encoding alpha 4, alpha 2 and gamma 1 subunits of the GABA A receptor. Alteration of this gene is implicated in the pathogenetics of schizophrenia. [provided by RefSeq |
Molecular Mass : | 37.73 kDa |
AA Sequence : | TNEPSNMPYVKETVDRLLKGYDIRLRPDFGGPPVDVGMRIDVASIDMVSEVNMDYTLTMYFQQSWKDKRLSYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GABRB1 gamma-aminobutyric acid (GABA) A receptor, beta 1 [ Homo sapiens ] |
Official Symbol | GABRB1 |
Synonyms | GABRB1; gamma-aminobutyric acid (GABA) A receptor, beta 1; gamma-aminobutyric acid receptor subunit beta-1; GABA(A) receptor; beta 1; GABA(A) receptor, beta 1; GABA(A) receptor subunit beta-1; |
Gene ID | 2560 |
mRNA Refseq | NM_000812 |
Protein Refseq | NP_000803 |
MIM | 137190 |
UniProt ID | P18505 |
◆ Recombinant Proteins | ||
GABRB1-3430M | Recombinant Mouse GABRB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GABRB1-1548H | Recombinant Human GABRB1 Protein, His-tagged | +Inquiry |
GABRB1-2104R | Recombinant Rat GABRB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GABRB1-13097H | Recombinant Human GABRB1, His-tagged | +Inquiry |
GABRB1-4645H | Recombinant Human GABRB1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GABRB1-6062HCL | Recombinant Human GABRB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GABRB1 Products
Required fields are marked with *
My Review for All GABRB1 Products
Required fields are marked with *
0
Inquiry Basket