Recombinant Human GABRB3
Cat.No. : | GABRB3-28089TH |
Product Overview : | Recombinant fragment corresponding to amino acids 26-135 of Human GABA A Receptor beta 3 with an N terminal proprietary tag; Predicted MWt 37.73 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of the ligand-gated ionic channel family. The encoded protein is one of at least 13 distinct subunits of a multisubunit chloride channel that serves as the receptor for gamma-aminobutyric acid, the major inhibitory transmitter of the nervous system. This gene is located on the long arm of chromosome 15 in a cluster with two genes encoding related subunits of the family. Mutations in this gene may be associated with the pathogenesis of Angelman syndrome, Prader-Willi syndrome, and autism. Alternatively spliced transcript variants encoding distinct isoforms have been described. |
Protein length : | 110 amino acids |
Molecular Weight : | 37.730kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | QSVNDPGNMSFVKETVDKLLKGYDIRLRPDFGGPPVCVGM NIDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYSGIPLN LTLDNRVADQLWVPDTYFLNDKKSFVHGVT |
Sequence Similarities : | Belongs to the ligand-gated ion channel (TC 1.A.9) family. Gamma-aminobutyric acid receptor (TC 1.A.9.5) subfamily. GABRB3 sub-subfamily. |
Gene Name : | GABRB3 gamma-aminobutyric acid (GABA) A receptor, beta 3 [ Homo sapiens ] |
Official Symbol : | GABRB3 |
Synonyms : | GABRB3; gamma-aminobutyric acid (GABA) A receptor, beta 3; gamma-aminobutyric acid receptor subunit beta-3; |
Gene ID : | 2562 |
mRNA Refseq : | NM_021912 |
Protein Refseq : | NP_068712 |
Uniprot ID : | P28472 |
Chromosome Location : | 15q11.2-q12 |
Pathway : | GABA A receptor activation, organism-specific biosystem; GABA receptor activation, organism-specific biosystem; GABAergic synapse, organism-specific biosystem; GABAergic synapse, conserved biosystem; Ion channel transport, organism-specific biosystem; |
Function : | GABA-A receptor activity; chloride channel activity; extracellular ligand-gated ion channel activity; ion channel activity; receptor activity; |
Products Types
◆ Recombinant Protein | ||
GABRB3-4647H | Recombinant Human GABRB3 Protein, GST-tagged | +Inquiry |
GABRB3-1616R | Recombinant Rhesus Macaque GABRB3 Protein, His (Fc)-Avi-tagged | +Inquiry |
GABRB3-0625H | Recombinant Human GABRB3 Protein (M1-F332, A447-N473 end), twin-StrepII tagged | +Inquiry |
GABRB3-05H | Recombinant Human GABRB3 Protein (M1-F332, SQPARAA, A447-N473 end), C-StrepII-tagged | +Inquiry |
GABRB3-2106R | Recombinant Rat GABRB3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
GABRB3-6060HCL | Recombinant Human GABRB3 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket