Recombinant Human GABRB3
Cat.No. : | GABRB3-28089TH |
Product Overview : | Recombinant fragment corresponding to amino acids 26-135 of Human GABA A Receptor beta 3 with an N terminal proprietary tag; Predicted MWt 37.73 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 110 amino acids |
Description : | This gene encodes a member of the ligand-gated ionic channel family. The encoded protein is one of at least 13 distinct subunits of a multisubunit chloride channel that serves as the receptor for gamma-aminobutyric acid, the major inhibitory transmitter of the nervous system. This gene is located on the long arm of chromosome 15 in a cluster with two genes encoding related subunits of the family. Mutations in this gene may be associated with the pathogenesis of Angelman syndrome, Prader-Willi syndrome, and autism. Alternatively spliced transcript variants encoding distinct isoforms have been described. |
Molecular Weight : | 37.730kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | QSVNDPGNMSFVKETVDKLLKGYDIRLRPDFGGPPVCVGM NIDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYSGIPLN LTLDNRVADQLWVPDTYFLNDKKSFVHGVT |
Sequence Similarities : | Belongs to the ligand-gated ion channel (TC 1.A.9) family. Gamma-aminobutyric acid receptor (TC 1.A.9.5) subfamily. GABRB3 sub-subfamily. |
Gene Name | GABRB3 gamma-aminobutyric acid (GABA) A receptor, beta 3 [ Homo sapiens ] |
Official Symbol | GABRB3 |
Synonyms | GABRB3; gamma-aminobutyric acid (GABA) A receptor, beta 3; gamma-aminobutyric acid receptor subunit beta-3; |
Gene ID | 2562 |
mRNA Refseq | NM_021912 |
Protein Refseq | NP_068712 |
Uniprot ID | P28472 |
Chromosome Location | 15q11.2-q12 |
Pathway | GABA A receptor activation, organism-specific biosystem; GABA receptor activation, organism-specific biosystem; GABAergic synapse, organism-specific biosystem; GABAergic synapse, conserved biosystem; Ion channel transport, organism-specific biosystem; |
Function | GABA-A receptor activity; chloride channel activity; extracellular ligand-gated ion channel activity; ion channel activity; receptor activity; |
◆ Cell & Tissue Lysates | ||
GABRB3-6060HCL | Recombinant Human GABRB3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GABRB3 Products
Required fields are marked with *
My Review for All GABRB3 Products
Required fields are marked with *