Recombinant Human GABRB3 Protein, GST-tagged
Cat.No. : | GABRB3-4647H |
Product Overview : | Human GABRB3 partial ORF ( AAH10641, 26 a.a. - 135 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the ligand-gated ionic channel family. The encoded protein is one of at least 13 distinct subunits of a multisubunit chloride channel that serves as the receptor for gamma-aminobutyric acid, the major inhibitory transmitter of the nervous system. This gene is located on the long arm of chromosome 15 in a cluster with two genes encoding related subunits of the family. Mutations in this gene may be associated with the pathogenesis of Angelman syndrome, Prader-Willi syndrome, and autism. Alternatively spliced transcript variants encoding isoforms with distinct signal peptides have been described. [provided by RefSeq |
Molecular Mass : | 37.84 kDa |
AA Sequence : | QSVNDPGNMSFVKETVDKLLKGYDIRLRPDFGGPPVCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GABRB3 gamma-aminobutyric acid (GABA) A receptor, beta 3 [ Homo sapiens ] |
Official Symbol | GABRB3 |
Synonyms | GABRB3; gamma-aminobutyric acid (GABA) A receptor, beta 3; gamma-aminobutyric acid receptor subunit beta-3; GABA(A) receptor; beta 3; GABA(A) receptor, beta 3; GABAA receptor beta-3 subunit; GABA(A) receptor beta-3 subunit; GABA-alpha receptor beta-2 subunit; ECA5; MGC9051; |
Gene ID | 2562 |
mRNA Refseq | NM_000814 |
Protein Refseq | NP_000805 |
MIM | 137192 |
UniProt ID | P28472 |
◆ Recombinant Proteins | ||
GABRB3-2106R | Recombinant Rat GABRB3 Protein, His (Fc)-Avi-tagged | +Inquiry |
GABRB3-05H | Recombinant Human GABRB3 Protein (M1-F332, SQPARAA, A447-N473 end), C-StrepII-tagged | +Inquiry |
GABRB3-1550H | Recombinant Human GABRB3 Protein, His&GST-tagged | +Inquiry |
GABRB3-2450R | Recombinant Rat GABRB3 Protein | +Inquiry |
GABRB3-1616R | Recombinant Rhesus Macaque GABRB3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GABRB3-6060HCL | Recombinant Human GABRB3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GABRB3 Products
Required fields are marked with *
My Review for All GABRB3 Products
Required fields are marked with *