Recombinant Human GADD45A protein, His-tagged
| Cat.No. : | GADD45A-3482H |
| Product Overview : | Recombinant Human GADD45A protein(94-165 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 29, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 94-165 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | NPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | GADD45A growth arrest and DNA-damage-inducible, alpha [ Homo sapiens ] |
| Official Symbol | GADD45A |
| Synonyms | GADD45A; growth arrest and DNA-damage-inducible, alpha; DDIT1; growth arrest and DNA damage-inducible protein GADD45 alpha; GADD45; DDIT-1; DNA damage-inducible transcript-1; DNA-damage-inducible transcript 1; DNA damage-inducible transcript 1 protein; growth arrest and DNA-damage-inducible 45 alpha; |
| Gene ID | 1647 |
| mRNA Refseq | NM_001199741 |
| Protein Refseq | NP_001186670 |
| MIM | 126335 |
| UniProt ID | P24522 |
| ◆ Recombinant Proteins | ||
| GADD45A-146H | Recombinant Full Length Human growth arrest and DNA-damage-inducible, alpha Protein, His&Flag&StrepII tagged | +Inquiry |
| GADD45A-5206HF | Recombinant Full Length Human GADD45A Protein, GST-tagged | +Inquiry |
| GADD45A-2936H | Recombinant Human GADD45A protein, His-SUMO-tagged | +Inquiry |
| GADD45A-6162M | Recombinant Mouse GADD45A Protein | +Inquiry |
| GADD45A-3470C | Recombinant Chicken GADD45A | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GADD45A-575HCL | Recombinant Human GADD45A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GADD45A Products
Required fields are marked with *
My Review for All GADD45A Products
Required fields are marked with *
