Recombinant Human GAGE2B Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: GAGE2B-2487H
• Product Overview: GAGE2B MS Standard C13 and N15-labeled recombinant protein (NP_001091881) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Antigen, recognized on melanoma by autologous cytolytic T-lymphocytes.
• Molecular Mass: 12.6 kDa
• AA Sequence: MSWRGRSTYRPRPRRYVEPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: GAGE2B G antigen 2B [ Homo sapiens (human) ]
• Official Symbol: GAGE2B
• Synonyms: GAGE2B; G antigen 2B; CT4.2; GAGE-2; GAGE-2B; G antigen 2B/2C; cancer/testis antigen 4.2; g antigen 2A/2B
• Gene ID: 645037
• mRNA Refseq: NM_001098411
• Protein Refseq: NP_001091881
• MIM: 300726
• UniProt ID: Q13066