Recombinant Human GAGE2B Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | GAGE2B-2487H |
| Product Overview : | GAGE2B MS Standard C13 and N15-labeled recombinant protein (NP_001091881) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Antigen, recognized on melanoma by autologous cytolytic T-lymphocytes. |
| Molecular Mass : | 12.6 kDa |
| AA Sequence : | MSWRGRSTYRPRPRRYVEPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | GAGE2B G antigen 2B [ Homo sapiens (human) ] |
| Official Symbol | GAGE2B |
| Synonyms | GAGE2B; G antigen 2B; CT4.2; GAGE-2; GAGE-2B; G antigen 2B/2C; cancer/testis antigen 4.2; g antigen 2A/2B |
| Gene ID | 645037 |
| mRNA Refseq | NM_001098411 |
| Protein Refseq | NP_001091881 |
| MIM | 300726 |
| UniProt ID | Q13066 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GAGE2B Products
Required fields are marked with *
My Review for All GAGE2B Products
Required fields are marked with *



