Recombinant Human GAGE2B Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : GAGE2B-2487H
Product Overview : GAGE2B MS Standard C13 and N15-labeled recombinant protein (NP_001091881) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Antigen, recognized on melanoma by autologous cytolytic T-lymphocytes.
Molecular Mass : 12.6 kDa
AA Sequence : MSWRGRSTYRPRPRRYVEPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name GAGE2B G antigen 2B [ Homo sapiens (human) ]
Official Symbol GAGE2B
Synonyms GAGE2B; G antigen 2B; CT4.2; GAGE-2; GAGE-2B; G antigen 2B/2C; cancer/testis antigen 4.2; g antigen 2A/2B
Gene ID 645037
mRNA Refseq NM_001098411
Protein Refseq NP_001091881
MIM 300726
UniProt ID Q13066

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GAGE2B Products

Required fields are marked with *

My Review for All GAGE2B Products

Required fields are marked with *

0
cart-icon
0
compare icon