Recombinant Human GAK protein, GST-tagged
Cat.No. : | GAK-28312TH |
Product Overview : | Recombinant Human GAK(151 a.a. - 250 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 151-250 a.a. |
Description : | In all eukaryotes, the cell cycle is governed by cyclin-dependent protein kinases (CDKs), whose activities are regulated by cyclins and CDK inhibitors in a diverse array of mechanisms that involve the control of phosphorylation and dephosphorylation of Ser, Thr or Tyr residues. Cyclins are molecules that possess a consensus domain called the 'cyclin box.' In mammalian cells, 9 cyclin species have been identified, and they are referred to as cyclins A through I. Cyclin G is a direct transcriptional target of the p53 tumor suppressor gene product and thus functions downstream of p53. GAK is an association partner of cyclin G and CDK5. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.63 kDa |
AA Sequence : | SAVAPTPATEGPLFSPGGQPAPCGSQASWTKSQNPDPFADLGDLSSGLQGSPAGFPPGGFIPKTATTPKGSSSWQTSRPPAQGASWPPQAKPPPKACTQP |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | GAK cyclin G associated kinase [ Homo sapiens ] |
Official Symbol | GAK |
Synonyms | GAK; cyclin G associated kinase; cyclin-G-associated kinase; auxilin 2; DNAJC26; auxilin-2; DNAJ26; FLJ16629; FLJ40395; MGC99654; |
Gene ID | 2580 |
mRNA Refseq | NM_005255 |
Protein Refseq | NP_005246 |
MIM | 602052 |
UniProt ID | O14976 |
Chromosome Location | 4p16 |
Pathway | Clathrin derived vesicle budding, organism-specific biosystem; Golgi Associated Vesicle Biogenesis, organism-specific biosystem; Membrane Trafficking, organism-specific biosystem; trans-Golgi Network Vesicle Budding, organism-specific biosystem; |
Function | ATP binding; cyclin binding; heat shock protein binding; nucleotide binding; protein kinase activity; protein serine/threonine kinase activity; transferase activity, transferring phosphorus-containing groups; |
◆ Recombinant Proteins | ||
GAK-6167M | Recombinant Mouse GAK Protein | +Inquiry |
GAK-01H | Recombinant Human GAK Protein, Myc/DDK-tagged | +Inquiry |
GAK-1336HFL | Recombinant Full Length Human GAK Protein, C-Flag-tagged | +Inquiry |
GAK-3442M | Recombinant Mouse GAK Protein, His (Fc)-Avi-tagged | +Inquiry |
GAK-15H | Recombinant Human GAK protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GAK-6047HCL | Recombinant Human GAK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GAK Products
Required fields are marked with *
My Review for All GAK Products
Required fields are marked with *
0
Inquiry Basket