Recombinant Human GAK protein, GST-tagged

• Cat.No.: GAK-28312TH
• Product Overview: Recombinant Human GAK(151 a.a. - 250 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 151-250 a.a.
• Description: In all eukaryotes, the cell cycle is governed by cyclin-dependent protein kinases (CDKs), whose activities are regulated by cyclins and CDK inhibitors in a diverse array of mechanisms that involve the control of phosphorylation and dephosphorylation of Ser, Thr or Tyr residues. Cyclins are molecules that possess a consensus domain called the 'cyclin box.' In mammalian cells, 9 cyclin species have been identified, and they are referred to as cyclins A through I. Cyclin G is a direct transcriptional target of the p53 tumor suppressor gene product and thus functions downstream of p53. GAK is an association partner of cyclin G and CDK5. Alternative splicing results in multiple transcript variants encoding different isoforms.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.63 kDa
• AA Sequence: SAVAPTPATEGPLFSPGGQPAPCGSQASWTKSQNPDPFADLGDLSSGLQGSPAGFPPGGFIPKTATTPKGSSSWQTSRPPAQGASWPPQAKPPPKACTQP
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: GAK cyclin G associated kinase [ Homo sapiens ]
• Official Symbol: GAK
• Synonyms: GAK; cyclin G associated kinase; cyclin-G-associated kinase; auxilin 2; DNAJC26; auxilin-2; DNAJ26; FLJ16629; FLJ40395; MGC99654
• Gene ID: 2580
• mRNA Refseq: NM_005255
• Protein Refseq: NP_005246
• MIM: 602052
• UniProt ID: O14976
• Chromosome Location: 4p16
• Pathway: Clathrin derived vesicle budding, organism-specific biosystem; Golgi Associated Vesicle Biogenesis, organism-specific biosystem; Membrane Trafficking, organism-specific biosystem; trans-Golgi Network Vesicle Budding, organism-specific biosystem
• Function: ATP binding; cyclin binding; heat shock protein binding; nucleotide binding; protein kinase activity; protein serine/threonine kinase activity; transferase activity, transferring phosphorus-containing groups