Recombinant Human GAK protein, GST-tagged
| Cat.No. : | GAK-28312TH |
| Product Overview : | Recombinant Human GAK(151 a.a. - 250 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 151-250 a.a. |
| Description : | In all eukaryotes, the cell cycle is governed by cyclin-dependent protein kinases (CDKs), whose activities are regulated by cyclins and CDK inhibitors in a diverse array of mechanisms that involve the control of phosphorylation and dephosphorylation of Ser, Thr or Tyr residues. Cyclins are molecules that possess a consensus domain called the 'cyclin box.' In mammalian cells, 9 cyclin species have been identified, and they are referred to as cyclins A through I. Cyclin G is a direct transcriptional target of the p53 tumor suppressor gene product and thus functions downstream of p53. GAK is an association partner of cyclin G and CDK5. Alternative splicing results in multiple transcript variants encoding different isoforms. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 36.63 kDa |
| AA Sequence : | SAVAPTPATEGPLFSPGGQPAPCGSQASWTKSQNPDPFADLGDLSSGLQGSPAGFPPGGFIPKTATTPKGSSSWQTSRPPAQGASWPPQAKPPPKACTQP |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | GAK cyclin G associated kinase [ Homo sapiens ] |
| Official Symbol | GAK |
| Synonyms | GAK; cyclin G associated kinase; cyclin-G-associated kinase; auxilin 2; DNAJC26; auxilin-2; DNAJ26; FLJ16629; FLJ40395; MGC99654; |
| Gene ID | 2580 |
| mRNA Refseq | NM_005255 |
| Protein Refseq | NP_005246 |
| MIM | 602052 |
| UniProt ID | O14976 |
| Chromosome Location | 4p16 |
| Pathway | Clathrin derived vesicle budding, organism-specific biosystem; Golgi Associated Vesicle Biogenesis, organism-specific biosystem; Membrane Trafficking, organism-specific biosystem; trans-Golgi Network Vesicle Budding, organism-specific biosystem; |
| Function | ATP binding; cyclin binding; heat shock protein binding; nucleotide binding; protein kinase activity; protein serine/threonine kinase activity; transferase activity, transferring phosphorus-containing groups; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GAK Products
Required fields are marked with *
My Review for All GAK Products
Required fields are marked with *
