Recombinant Human GAK protein, GST-tagged

Cat.No. : GAK-28312TH
Product Overview : Recombinant Human GAK(151 a.a. - 250 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 151-250 a.a.
Description : In all eukaryotes, the cell cycle is governed by cyclin-dependent protein kinases (CDKs), whose activities are regulated by cyclins and CDK inhibitors in a diverse array of mechanisms that involve the control of phosphorylation and dephosphorylation of Ser, Thr or Tyr residues. Cyclins are molecules that possess a consensus domain called the 'cyclin box.' In mammalian cells, 9 cyclin species have been identified, and they are referred to as cyclins A through I. Cyclin G is a direct transcriptional target of the p53 tumor suppressor gene product and thus functions downstream of p53. GAK is an association partner of cyclin G and CDK5. Alternative splicing results in multiple transcript variants encoding different isoforms.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.63 kDa
AA Sequence : SAVAPTPATEGPLFSPGGQPAPCGSQASWTKSQNPDPFADLGDLSSGLQGSPAGFPPGGFIPKTATTPKGSSSWQTSRPPAQGASWPPQAKPPPKACTQP
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name GAK cyclin G associated kinase [ Homo sapiens ]
Official Symbol GAK
Synonyms GAK; cyclin G associated kinase; cyclin-G-associated kinase; auxilin 2; DNAJC26; auxilin-2; DNAJ26; FLJ16629; FLJ40395; MGC99654;
Gene ID 2580
mRNA Refseq NM_005255
Protein Refseq NP_005246
MIM 602052
UniProt ID O14976
Chromosome Location 4p16
Pathway Clathrin derived vesicle budding, organism-specific biosystem; Golgi Associated Vesicle Biogenesis, organism-specific biosystem; Membrane Trafficking, organism-specific biosystem; trans-Golgi Network Vesicle Budding, organism-specific biosystem;
Function ATP binding; cyclin binding; heat shock protein binding; nucleotide binding; protein kinase activity; protein serine/threonine kinase activity; transferase activity, transferring phosphorus-containing groups;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GAK Products

Required fields are marked with *

My Review for All GAK Products

Required fields are marked with *

0
cart-icon
0
compare icon