Recombinant Human GAL protein(41-120 aa), C-His-tagged
Cat.No. : | GAL-2698H |
Product Overview : | Recombinant Human GAL protein(P22466)(41-120 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 41-120 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | YLLGPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDI |
Gene Name | GAL galanin prepropeptide [ Homo sapiens ] |
Official Symbol | GAL |
Synonyms | GAL; galanin prepropeptide; galanin , GALN; galanin peptides; galanin message associated peptide; GLNN; GMAP; galanin-related peptide; galanin-message-associated peptide; GALN; MGC40167; |
Gene ID | 51083 |
mRNA Refseq | NM_015973 |
Protein Refseq | NP_057057 |
MIM | 137035 |
UniProt ID | P22466 |
◆ Recombinant Proteins | ||
GAL-2461R | Recombinant Rat GAL Protein | +Inquiry |
Gal-1483M | Recombinant Mouse Gal protein, His & T7-tagged | +Inquiry |
GAL-6168M | Recombinant Mouse GAL Protein | +Inquiry |
GAL-5218HF | Recombinant Full Length Human GAL Protein, GST-tagged | +Inquiry |
GAL-3917C | Recombinant Chicken GAL | +Inquiry |
◆ Cell & Tissue Lysates | ||
GAL-759HCL | Recombinant Human GAL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GAL Products
Required fields are marked with *
My Review for All GAL Products
Required fields are marked with *