Recombinant Human GAL protein(41-120 aa), C-His-tagged
| Cat.No. : | GAL-2698H |
| Product Overview : | Recombinant Human GAL protein(P22466)(41-120 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 41-120 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | YLLGPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDI |
| Gene Name | GAL galanin prepropeptide [ Homo sapiens ] |
| Official Symbol | GAL |
| Synonyms | GAL; galanin prepropeptide; galanin , GALN; galanin peptides; galanin message associated peptide; GLNN; GMAP; galanin-related peptide; galanin-message-associated peptide; GALN; MGC40167; |
| Gene ID | 51083 |
| mRNA Refseq | NM_015973 |
| Protein Refseq | NP_057057 |
| MIM | 137035 |
| UniProt ID | P22466 |
| ◆ Recombinant Proteins | ||
| GAL-2117R | Recombinant Rat GAL Protein, His (Fc)-Avi-tagged | +Inquiry |
| GAL-5218HF | Recombinant Full Length Human GAL Protein, GST-tagged | +Inquiry |
| GAL-2461R | Recombinant Rat GAL Protein | +Inquiry |
| GAL-6168M | Recombinant Mouse GAL Protein | +Inquiry |
| GAL-3002H | Recombinant Human GAL Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GAL-759HCL | Recombinant Human GAL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GAL Products
Required fields are marked with *
My Review for All GAL Products
Required fields are marked with *
