Recombinant Human GAL protein, GST-tagged
Cat.No. : | GAL-301190H |
Product Overview : | Recombinant Human GAL protein(45-123 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 45-123 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | PHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDIERS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | GAL galanin prepropeptide [ Homo sapiens ] |
Official Symbol | GAL |
Synonyms | GAL; galanin prepropeptide; galanin , GALN; galanin peptides; galanin message associated peptide; GLNN; GMAP; galanin-related peptide; galanin-message-associated peptide; GALN; MGC40167; |
Gene ID | 51083 |
mRNA Refseq | NM_015973 |
Protein Refseq | NP_057057 |
MIM | 137035 |
UniProt ID | P22466 |
◆ Recombinant Proteins | ||
GAL-3443M | Recombinant Mouse GAL Protein, His (Fc)-Avi-tagged | +Inquiry |
GAL-289H | Recombinant Human GAL, Fc-tagged | +Inquiry |
GAL-5218HF | Recombinant Full Length Human GAL Protein, GST-tagged | +Inquiry |
GAL-3002H | Recombinant Human GAL Protein, His (Fc)-Avi-tagged | +Inquiry |
Gal-1484R | Recombinant Rat Gal protein, His & GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GAL-759HCL | Recombinant Human GAL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GAL Products
Required fields are marked with *
My Review for All GAL Products
Required fields are marked with *