Recombinant Human GAL protein, GST-tagged
Cat.No. : | GAL-301190H |
Product Overview : | Recombinant Human GAL (45-123 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Pro45-Ser123 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | PHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDIERS |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | GAL galanin prepropeptide [ Homo sapiens ] |
Official Symbol | GAL |
Synonyms | GAL; galanin prepropeptide; galanin , GALN; galanin peptides; galanin message associated peptide; GLNN; GMAP; galanin-related peptide; galanin-message-associated peptide; GALN; MGC40167; |
Gene ID | 51083 |
mRNA Refseq | NM_015973 |
Protein Refseq | NP_057057 |
MIM | 137035 |
UniProt ID | P22466 |
◆ Recombinant Proteins | ||
GAL-3917C | Recombinant Chicken GAL | +Inquiry |
GAL-6168M | Recombinant Mouse GAL Protein | +Inquiry |
Gal-1483M | Recombinant Mouse Gal protein, His & T7-tagged | +Inquiry |
GAL-2117R | Recombinant Rat GAL Protein, His (Fc)-Avi-tagged | +Inquiry |
GAL-2461R | Recombinant Rat GAL Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GAL-759HCL | Recombinant Human GAL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GAL Products
Required fields are marked with *
My Review for All GAL Products
Required fields are marked with *
0
Inquiry Basket