Recombinant Human GALE, His-tagged
Cat.No. : | GALE-28967TH |
Product Overview : | Recombinant full length Human GALE with N terminal His tag; 368 amino acids, MWt 40.4kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 348 amino acids |
Description : | This gene encodes UDP-galactose-4-epimerase which catalyzes two distinct but analogous reactions: the epimerization of UDP-glucose to UDP-galactose, and the epimerization of UDP-N-acetylglucosamine to UDP-N-acetylgalactosamine. The bifunctional nature of the enzyme has the important metabolic consequence that mutant cells (or individuals) are dependent not only on exogenous galactose, but also on exogenous N-acetylgalactosamine as a necessary precursor for the synthesis of glycoproteins and glycolipids. Mutations in this gene result in epimerase-deficiency galactosemia, also referred to as galactosemia type 3, a disease characterized by liver damage, early-onset cataracts, deafness and mental retardation, with symptoms ranging from mild (peripheral form) to severe (generalized form). Multiple alternatively spliced transcripts encoding the same protein have been identified. |
Conjugation : | HIS |
Molecular Weight : | 40.400kDa inclusive of tags |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 5mM DTT, 20mM Tris HCl, 1mM EDTA, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA |
Sequence Similarities : | Belongs to the sugar epimerase family. |
Gene Name | GALE UDP-galactose-4-epimerase [ Homo sapiens ] |
Official Symbol | GALE |
Synonyms | GALE; UDP-galactose-4-epimerase; galactose 4 epimerase, UDP; UDP-glucose 4-epimerase; SDR1E1; short chain dehydrogenase/reductase family 1E; member 1; UDP glucose 4 epimerase; |
Gene ID | 2582 |
mRNA Refseq | NM_000403 |
Protein Refseq | NP_000394 |
MIM | 606953 |
Uniprot ID | Q14376 |
Chromosome Location | 1p36-p35 |
Pathway | Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem; Galactose catabolism, organism-specific biosystem; Galactose metabolism, organism-specific biosystem; Galactose metabolism, conserved biosystem; |
Function | UDP-glucose 4-epimerase activity; UDP-glucose 4-epimerase activity; UDP-glucose 4-epimerase activity; catalytic activity; coenzyme binding; |
◆ Recombinant Proteins | ||
GALE-1625R | Recombinant Rhesus Macaque GALE Protein, His (Fc)-Avi-tagged | +Inquiry |
GALE-1804R | Recombinant Rhesus monkey GALE Protein, His-tagged | +Inquiry |
GALE-1409B | Recombinant Bacillus subtilis GALE protein, His-tagged | +Inquiry |
GALE-3741Z | Recombinant Zebrafish GALE | +Inquiry |
GALE-330H | Recombinant Human GALE protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GALE-6043HCL | Recombinant Human GALE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GALE Products
Required fields are marked with *
My Review for All GALE Products
Required fields are marked with *
0
Inquiry Basket