Recombinant Human GALE protein, His-SUMO-tagged

• Cat.No.: GALE-4370H
• Product Overview: Recombinant Human GALE protein(Q14376)(1-348aa), fused to N-terminal His-SUMO tag, was expressed in E. coli

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-348aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 54.3 kDa
• AA Sequence: MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: GALE UDP-galactose-4-epimerase [ Homo sapiens ]
• Official Symbol: GALE
• Synonyms: GALE; UDP-galactose-4-epimerase; galactose 4 epimerase, UDP; UDP-glucose 4-epimerase; SDR1E1; short chain dehydrogenase/reductase family 1E; member 1; UDP glucose 4 epimerase; galactowaldenase; UDP-galactose 4-epimerase; UDP galactose-4-epimerase; galactose-4-epimerase, UDP-; short chain dehydrogenase/reductase family 1E, member 1; FLJ95174; FLJ97302
• Gene ID: 2582
• mRNA Refseq: NM_000403
• Protein Refseq: NP_000394
• MIM: 606953
• UniProt ID: Q14376