Recombinant Human GALE protein, His-SUMO-tagged
Cat.No. : | GALE-4370H |
Product Overview : | Recombinant Human GALE protein(Q14376)(1-348aa), fused to N-terminal His-SUMO tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-348aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 54.3 kDa |
AA Sequence : | MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | GALE UDP-galactose-4-epimerase [ Homo sapiens ] |
Official Symbol | GALE |
Synonyms | GALE; UDP-galactose-4-epimerase; galactose 4 epimerase, UDP; UDP-glucose 4-epimerase; SDR1E1; short chain dehydrogenase/reductase family 1E; member 1; UDP glucose 4 epimerase; galactowaldenase; UDP-galactose 4-epimerase; UDP galactose-4-epimerase; galactose-4-epimerase, UDP-; short chain dehydrogenase/reductase family 1E, member 1; FLJ95174; FLJ97302; |
Gene ID | 2582 |
mRNA Refseq | NM_000403 |
Protein Refseq | NP_000394 |
MIM | 606953 |
UniProt ID | Q14376 |
◆ Recombinant Proteins | ||
Gale-3136M | Recombinant Mouse Gale Protein, Myc/DDK-tagged | +Inquiry |
GALE-1804R | Recombinant Rhesus monkey GALE Protein, His-tagged | +Inquiry |
GALE-5226HF | Recombinant Full Length Human GALE Protein, GST-tagged | +Inquiry |
GALE-731H | Recombinant Human UDP-galactose-4-epimerase, His-tagged | +Inquiry |
GALE-4370H | Recombinant Human GALE protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GALE-6043HCL | Recombinant Human GALE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GALE Products
Required fields are marked with *
My Review for All GALE Products
Required fields are marked with *
0
Inquiry Basket