Recombinant Human GALE protein, His-SUMO-tagged
| Cat.No. : | GALE-4370H |
| Product Overview : | Recombinant Human GALE protein(Q14376)(1-348aa), fused to N-terminal His-SUMO tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-348aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 54.3 kDa |
| AA Sequence : | MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | GALE UDP-galactose-4-epimerase [ Homo sapiens ] |
| Official Symbol | GALE |
| Synonyms | GALE; UDP-galactose-4-epimerase; galactose 4 epimerase, UDP; UDP-glucose 4-epimerase; SDR1E1; short chain dehydrogenase/reductase family 1E; member 1; UDP glucose 4 epimerase; galactowaldenase; UDP-galactose 4-epimerase; UDP galactose-4-epimerase; galactose-4-epimerase, UDP-; short chain dehydrogenase/reductase family 1E, member 1; FLJ95174; FLJ97302; |
| Gene ID | 2582 |
| mRNA Refseq | NM_000403 |
| Protein Refseq | NP_000394 |
| MIM | 606953 |
| UniProt ID | Q14376 |
| ◆ Recombinant Proteins | ||
| GALE-5810H | Recombinant Human GALE Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Gale-3136M | Recombinant Mouse Gale Protein, Myc/DDK-tagged | +Inquiry |
| GALE-9778H | Recombinant Human GALE protein | +Inquiry |
| GALE-3741Z | Recombinant Zebrafish GALE | +Inquiry |
| GALE-13126H | Recombinant Human GALE, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GALE-6043HCL | Recombinant Human GALE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GALE Products
Required fields are marked with *
My Review for All GALE Products
Required fields are marked with *
