Recombinant Human GALK2, His-tagged
| Cat.No. : | GALK2-28969TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 265-445 of Human GALK2 with N terminal His tag; 191 amino acids, 22kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 265-445 a.a. |
| Description : | This gene encodes a highly efficient N-acetylgalactosamine (GalNAc) kinase, which has galactokinase activity when galactose is present at high concentrations. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 114 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | LRLEEVQAKLGISLEEMLLVTEDALHPEPYNPEEICRCLG ISLEELRTQILSPNTQDVLIFKLYQRAKHVYSEAARVL QFKKICEEAPENMVQLLGELMNQSHMSCRDMYECSCPELD QLVDICRKFGAQGSRLTGAGWGGCTVSMVPADKLPSFL ANVHKAYYQRSDGSLAPEKQSLFATKPGGGALVLL |
| Gene Name | GALK2 galactokinase 2 [ Homo sapiens ] |
| Official Symbol | GALK2 |
| Synonyms | GALK2; galactokinase 2; N-acetylgalactosamine kinase; GK2; |
| Gene ID | 2585 |
| mRNA Refseq | NM_001001556 |
| Protein Refseq | NP_001001556 |
| MIM | 137028 |
| Uniprot ID | Q01415 |
| Chromosome Location | 15 |
| Pathway | Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem; Galactose metabolism, organism-specific biosystem; Galactose metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; |
| Function | ATP binding; N-acetylgalactosamine kinase activity; galactokinase activity; galactokinase activity; kinase activity; |
| ◆ Recombinant Proteins | ||
| GALK2-4683H | Recombinant Human GALK2 Protein, GST-tagged | +Inquiry |
| GALK2-2271C | Recombinant Chicken GALK2 | +Inquiry |
| Galk2-3138M | Recombinant Mouse Galk2 Protein, Myc/DDK-tagged | +Inquiry |
| GALK2-2462R | Recombinant Rat GALK2 Protein | +Inquiry |
| GALK2-1602HFL | Recombinant Full Length Human GALK2 Protein, C-Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GALK2-6042HCL | Recombinant Human GALK2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GALK2 Products
Required fields are marked with *
My Review for All GALK2 Products
Required fields are marked with *
