Recombinant Full Length Human GALK2 Protein, C-Flag-tagged
Cat.No. : | GALK2-1602HFL |
Product Overview : | Recombinant Full Length Human GALK2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a highly efficient N-acetylgalactosamine (GalNAc) kinase, which has galactokinase activity when galactose is present at high concentrations. The encoded protein is a member of the GHMP kinase family. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 50.2 kDa |
AA Sequence : | MATESPATRRVQVAEHPRLLKLKEMFNSKFGSIPKFYVRAPGRVNIIGEHIDYCGYSVLPMAVEQDVLIA VEPVKTYALQLANTNPLYPDFSTSANNIQIDKTKPLWHNYFLCGLKGIQEHFGLSNLTGMNCLVDGNIPP SSGLSSSSALVCCAGLVTLTVLGRNLSKVELAEICAKSERYIGTEGGGMDQSISFLAEEGTAKLIEFSPL RATDVKLPSGAVFVIANSCVEMNKAATSHFNIRVMECRLAAKLLAKYKSLQWDKVLRLEEVQAKLGISLE EMLLVTEDALHPEPYNPEEICRCLGISLEELRTQILSPNTQDVLIFKLYQRAKHVYSEAARVLQFKKICE EAPENMVQLLGELMNQSHMSCRDMYECSCPELDQLVDICRKFGAQGSRLTGAGWGGCTVSMVPADKLPSF LANVHKAYYQRSDGSLAPEKQSLFATKPGGGALVLLEASGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Amino sugar and nucleotide sugar metabolism, Galactose metabolism, Metabolic pathways |
Full Length : | Full L. |
Gene Name | GALK2 galactokinase 2 [ Homo sapiens (human) ] |
Official Symbol | GALK2 |
Synonyms | GK2 |
Gene ID | 2585 |
mRNA Refseq | NM_002044.4 |
Protein Refseq | NP_002035.1 |
MIM | 137028 |
UniProt ID | Q01415 |
◆ Recombinant Proteins | ||
GALK2-1810Z | Recombinant Zebrafish GALK2 | +Inquiry |
GALK2-1916H | Recombinant Human GALK2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GALK2-5181H | Recombinant Human GALK2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GALK2-28969TH | Recombinant Human GALK2, His-tagged | +Inquiry |
GALK2-958H | Recombinant Human GALK2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GALK2-6042HCL | Recombinant Human GALK2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GALK2 Products
Required fields are marked with *
My Review for All GALK2 Products
Required fields are marked with *
0
Inquiry Basket