Recombinant Human GALNS, GST-tagged
Cat.No. : | GALNS-101H |
Product Overview : | Recombinant Human GALNS (423 a.a. - 522 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes N-acetylgalactosamine-6-sulfatase which is a lysosomal exohydrolase required for the degradation of the glycosaminoglycans, keratan sulfate, and chondroitin 6-sulfate. Sequence alterations including point, missense and nonsense mutations, as well as those that affect splicing, result in a deficiency of this enzyme. Deficiencies of this enzyme lead to Morquio A syndrome, a lysosomal storage disorder. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | NVSGVTTHNLEDHTKLPLIFHLGRDPGERFPLSFASAEYQEALSRITSVVQQHQEALVPAQPQLNVCNWAVMNWA PPGCEKLGKCLTPPESIPKKCLWSH |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GALNS galactosamine (N-acetyl)-6-sulfate sulfatase [ Homo sapiens (human) ] |
Official Symbol | GALNS |
Synonyms | GALNS; GAS; MPS4A; GalN6S; GALNAC6S; galactosamine (N-acetyl)-6-sulfate sulfatase; N-acetylgalactosamine-6-sulfatase; chondroitinase; galNAc6S sulfatase; chondroitinsulfatase; galactose-6-sulfate sulfatase; N-acetylgalactosamine-6-sulfate sulfatase; NP_000503.1; EC 3.1.6.4 |
Gene ID | 2588 |
mRNA Refseq | NM_000512 |
Protein Refseq | NP_000503 |
MIM | 612222 |
UniProt ID | P34059 |
Chromosome Location | 16q24.3 |
Pathway | Chondroitin sulfate degradation; Keratan sulfate degradation; Lysosome |
Function | N-acetylgalactosamine-4-sulfatase activity; N-acetylgalactosamine-6-sulfatase activity; metal ion binding |
◆ Recombinant Proteins | ||
GALNS-0129H | Recombinant Human GALNS Protein (M1-H522), His tagged | +Inquiry |
GALNS-2464R | Recombinant Rat GALNS Protein | +Inquiry |
GALNS-3412H | Recombinant Human GALNS protein, His-tagged | +Inquiry |
GALNS-102H | Recombinant Human GALNS, GST-tagged | +Inquiry |
GALNS-5125Z | Recombinant Zebrafish GALNS | +Inquiry |
◆ Cell & Tissue Lysates | ||
GALNS-6040HCL | Recombinant Human GALNS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GALNS Products
Required fields are marked with *
My Review for All GALNS Products
Required fields are marked with *