Recombinant Human GALNS protein, His-tagged
| Cat.No. : | GALNS-3412H |
| Product Overview : | Recombinant Human GALNS protein(174-522 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 30, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 174-522 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | ARPNIPVYRDWEMVGRYYEEFPINLKTGEANLTQIYLQEALDFIKRQARHHPFFLYWAVDATHAPVYASKPFLGTSQRGRYGDAVREIDDSIGKILELLQDLHVADNTFVFFTSDNGAALISAPEQGGSNGPFLCGKQTTFEGGMREPALAWWPGHVTAGQVSHQLGSIMDLFTTSLALAGLTPPSDRAIDGLNLLPTLLQGRLMDRPIFYYRGDTLMAATLGQHKAHFWTWTNSWENFRQGIDFCPGQNVSGVTTHNLEDHTKLPLIFHLGRDPGERFPLSFASAEYQEALSRITSVVQQHQEALVPAQPQLNVCNWAVMNWAPPGCEKLGKCLTPPESIPKKCLWSH |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | GALNS galactosamine (N-acetyl)-6-sulfate sulfatase [ Homo sapiens ] |
| Official Symbol | GALNS |
| Synonyms | GALNS; galactosamine (N-acetyl)-6-sulfate sulfatase; N-acetylgalactosamine-6-sulfatase; GALNAC6S; GAS; Morquio syndrome; mucopolysaccharidosis type IVA; chondroitinase; galNAc6S sulfatase; chondroitinsulfatase; galactose-6-sulfate sulfatase; N-acetylgalactosamine-6-sulfate sulfatase; MPS4A; FLJ17434; FLJ42844; FLJ98217; |
| Gene ID | 2588 |
| mRNA Refseq | NM_000512 |
| Protein Refseq | NP_000503 |
| MIM | 612222 |
| UniProt ID | P34059 |
| ◆ Recombinant Proteins | ||
| GALNS-177HF | Recombinant Full Length Human GALNS Protein, GST-tagged | +Inquiry |
| GALNS-6178M | Recombinant Mouse GALNS Protein | +Inquiry |
| Galns-3140M | Recombinant Mouse Galns Protein, Myc/DDK-tagged | +Inquiry |
| GALNS-0129H | Recombinant Human GALNS Protein (M1-H522), His tagged | +Inquiry |
| GALNS-3412H | Recombinant Human GALNS protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GALNS-6040HCL | Recombinant Human GALNS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GALNS Products
Required fields are marked with *
My Review for All GALNS Products
Required fields are marked with *
