Recombinant Human GALNT3 protein, His-tagged

Cat.No. : GALNT3-3444H
Product Overview : Recombinant Human GALNT3 protein(1-176 aa), fused with N-terminal His tag, was expressed in E.coli.
Availability November 03, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-176 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
AASequence : MAHLKRLVKLHIKRHYHKKFWKLGAVIFFFIIVLVLMQREVSVQYSKEESRMERNMKNKNKMLDLMLEAVNNIKDAMPKMQIGAPVRQNIDAGERPCLQGYYTAAELKPVLDRPPQDSNAPGASGKAFKTTNLSVEEQKEKERGEAKHCFNAFASDRISLHRDLGPDTRPPEYVEE
Purity : 75%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name GALNT3 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 3 (GalNAc-T3) [ Homo sapiens ]
Official Symbol GALNT3
Synonyms GALNT3; UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 3 (GalNAc-T3); polypeptide N-acetylgalactosaminyltransferase 3; GalNAc T3; HFTC; HHS; pp-GaNTase 3; GalNAc transferase 3; polypeptide GalNAc transferase 3; polypeptide GalNAc-transferase T3; protein-UDP acetylgalactosaminyltransferase 3; UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 3; GalNAc-T3; MGC61909; DKFZp686C10199;
Gene ID 2591
mRNA Refseq NM_004482
Protein Refseq NP_004473
MIM 601756
UniProt ID Q14435

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GALNT3 Products

Required fields are marked with *

My Review for All GALNT3 Products

Required fields are marked with *

0
cart-icon
0
compare icon