Recombinant Human GALNT3 protein, His-tagged
Cat.No. : | GALNT3-3444H |
Product Overview : | Recombinant Human GALNT3 protein(1-176 aa), fused with N-terminal His tag, was expressed in E.coli. |
Availability | October 11, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-176 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | MAHLKRLVKLHIKRHYHKKFWKLGAVIFFFIIVLVLMQREVSVQYSKEESRMERNMKNKNKMLDLMLEAVNNIKDAMPKMQIGAPVRQNIDAGERPCLQGYYTAAELKPVLDRPPQDSNAPGASGKAFKTTNLSVEEQKEKERGEAKHCFNAFASDRISLHRDLGPDTRPPEYVEE |
Purity : | 75%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | GALNT3 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 3 (GalNAc-T3) [ Homo sapiens ] |
Official Symbol | GALNT3 |
Synonyms | GALNT3; UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 3 (GalNAc-T3); polypeptide N-acetylgalactosaminyltransferase 3; GalNAc T3; HFTC; HHS; pp-GaNTase 3; GalNAc transferase 3; polypeptide GalNAc transferase 3; polypeptide GalNAc-transferase T3; protein-UDP acetylgalactosaminyltransferase 3; UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 3; GalNAc-T3; MGC61909; DKFZp686C10199; |
Gene ID | 2591 |
mRNA Refseq | NM_004482 |
Protein Refseq | NP_004473 |
MIM | 601756 |
UniProt ID | Q14435 |
◆ Recombinant Proteins | ||
GALNT3-3451M | Recombinant Mouse GALNT3 Protein, His (Fc)-Avi-tagged | +Inquiry |
GALNT3-3006H | Recombinant Human GALNT3 Protein, His (Fc)-Avi-tagged | +Inquiry |
GALNT3-6186M | Recombinant Mouse GALNT3 Protein | +Inquiry |
GALNT3-3444H | Recombinant Human GALNT3 protein, His-tagged | +Inquiry |
GALNT3-5222HF | Recombinant Full Length Human GALNT3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GALNT3-682HCL | Recombinant Human GALNT3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GALNT3 Products
Required fields are marked with *
My Review for All GALNT3 Products
Required fields are marked with *