Recombinant Human GAMT Protein, GST-tagged
| Cat.No. : | GAMT-4715H |
| Product Overview : | Human GAMT full-length ORF (BAF82154.1, 1 a.a. - 269 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is a methyltransferase that converts guanidoacetate to creatine, using S-adenosylmethionine as the methyl donor. Defects in this gene have been implicated in neurologic syndromes and muscular hypotonia, probably due to creatine deficiency and accumulation of guanidinoacetate in the brain of affected individuals. Two transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq |
| Molecular Mass : | 55.99 kDa |
| AA Sequence : | MSAPSATPIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYMHALAAAASSKGGRVLEVGFGMAIAASKVQEAPIDEHWIIECNDGVFQRLRDWAPRQTHKVIPLKGLWEDVAPTLPDGHFDGILYDTYPLSEETWHTHQFNFIKNHAFRLLKPGGVLTYCNLTSWGELMKSKYSDITIMFEVRPPEVPHGSPGSDLGWGWEGAAGATLLPGEGPFLTPWVGWTVLVHLEIKVLCLAQWLPGAVAQVYNPSTVEGRGGQIA |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GAMT guanidinoacetate N-methyltransferase [ Homo sapiens ] |
| Official Symbol | GAMT |
| Synonyms | GAMT; guanidinoacetate N-methyltransferase; PIG2; TP53I2; |
| Gene ID | 2593 |
| mRNA Refseq | NM_000156 |
| Protein Refseq | NP_000147 |
| MIM | 601240 |
| UniProt ID | Q14353 |
| ◆ Recombinant Proteins | ||
| GAMT-483H | Recombinant Human Guanidinoacetate N-methyltransferase, His-tagged | +Inquiry |
| GAMT-1250H | Recombinant Human GAMT Protein, MYC/DDK-tagged | +Inquiry |
| GAMT-3009H | Recombinant Human GAMT Protein, His (Fc)-Avi-tagged | +Inquiry |
| GAMT-319H | Recombinant Human GAMT Protein, His-tagged | +Inquiry |
| GAMT-1630R | Recombinant Rhesus Macaque GAMT Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GAMT-684HCL | Recombinant Human GAMT cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GAMT Products
Required fields are marked with *
My Review for All GAMT Products
Required fields are marked with *
