Recombinant Human GAMT Protein, His-tagged

Cat.No. : GAMT-319H
Product Overview : Recombinant Human GAMT, transcript variant 1, fused with His tag at N, C-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : The protein encoded by this gene is a methyltransferase that converts guanidoacetate to creatine, using S-adenosylmethionine as the methyl donor. Defects in this gene have been implicated in neurologic syndromes and muscular hypotonia, probably due to creatine deficiency and accumulation of guanidinoacetate in the brain of affected individuals. Two transcript variants encoding different isoforms have been described for this gene. Pseudogenes of this gene are found on chromosomes 2 and 13.
Form : Supplied as a 0.2 µM filtered solution of 20mM Tris-HCl, 1mM DTT, pH 8.0
Molecular Mass : 29.5kD
Identity : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
AA Sequence : MGSSHHHHHHSSGLVPRGSHMSAPSATPIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYMHALAAAASSKGGRVLEVGFGMAIAASKVQEAPIDEHWIIECNDGVFQRLRDWAPRQTHKVIPLKGLWEDVAPTLPDGHFDGILYDTYPLSEETWHTHQFNFIKNHAFRLLKPGGVLTYCNLTSWGELMKSKYSDITIMFEETQVPALLEAGFRRENIRTEVMALVPPADCRYYAFPQMITPLVTK
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Gene Name GAMT guanidinoacetate N-methyltransferase [ Homo sapiens ]
Official Symbol GAMT
Synonyms GAMT; guanidinoacetate N-methyltransferase; PIG2; TP53I2;
Gene ID 2593
mRNA Refseq NM_000156
Protein Refseq NP_000147
MIM 601240
UniProt ID Q14353

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GAMT Products

Required fields are marked with *

My Review for All GAMT Products

Required fields are marked with *

0
cart-icon
0
compare icon