Recombinant Human GAR1 Protein, GST-tagged
Cat.No. : | GAR1-5978H |
Product Overview : | Human NOLA1 partial ORF ( NP_127460, 60 a.a. - 150 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA. The H/ACA snoRNPs also include the DKC1, NOLA2 and NOLA3 proteins. These four H/ACA snoRNP proteins localize to the dense fibrillar components of nucleoli and to coiled (Cajal) bodies in the nucleus. Both 18S rRNA production and rRNA pseudouridylation are impaired if any one of the four proteins is depleted. These four H/ACA snoRNP proteins are also components of the telomerase complex. The encoded protein of this gene contains two glycine- and arginine-rich domains and is related to Saccharomyces cerevisiae Gar1p. Two splice variants have been found for this gene. [provided by RefSeq |
Molecular Mass : | 35.75 kDa |
AA Sequence : | KGQDQGPPERVVLLGEFLHPCEDDIVCKCTTDENKVPYFNAPVYLENKEQIGKVDEIFGQLRDFYFSVKLSENMKASSFKKLQKFYIDPYK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GAR1 GAR1 ribonucleoprotein homolog (yeast) [ Homo sapiens ] |
Official Symbol | GAR1 |
Synonyms | GAR1 ribonucleoprotein homolog (yeast); 14264; Ensembl:ENSG00000109534; H/ACA ribonucleoprotein complex subunit 1;snoRNP protein GAR1;nucleolar protein family A member 1;nucleolar protein family A, member 1 (H/ACA small nucleolar RNPs); NOLA1 |
Gene ID | 54433 |
mRNA Refseq | NM_018983 |
Protein Refseq | NP_061856 |
MIM | 606468 |
UniProt ID | Q9NY12 |
◆ Recombinant Proteins | ||
GAR1-2478R | Recombinant Rat GAR1 Protein | +Inquiry |
GAR1-6209M | Recombinant Mouse GAR1 Protein | +Inquiry |
Gar1-4456M | Recombinant Mouse Gar1 Protein, Myc/DDK-tagged | +Inquiry |
GAR1-11210Z | Recombinant Zebrafish GAR1 | +Inquiry |
GAR1-5978H | Recombinant Human GAR1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GAR1-6021HCL | Recombinant Human GAR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GAR1 Products
Required fields are marked with *
My Review for All GAR1 Products
Required fields are marked with *
0
Inquiry Basket