Recombinant Human GARS, His-tagged
Cat.No. : | GARS-28978TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 413-734 of Human GARS with N terminal His tag, 322 amino acids, 37kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 413-734 a.a. |
Description : | This gene encodes glycyl-tRNA synthetase, one of the aminoacyl-tRNA synthetases that charge tRNAs with their cognate amino acids. The encoded enzyme is an (alpha)2 dimer which belongs to the class II family of tRNA synthetases. It has been shown to be a target of autoantibodies in the human autoimmune diseases, polymyositis or dermatomyositis. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 88 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | IYLYLTKVGISPDKLRFRQHMENEMAHYACDCWDAESKTS YGWIEIVGCADRSCYDLSCHARATKVPLVAEKPLKEPK TVNVVQFEPSKGAIGKAYKKDAKLVMEYLAICDECYIT EMEMLLNEKGEFTIETEGKTFQLTKDMINVKRFQKTLY VEEVVPNVIEPSFGLGRIMYTVFEHTFHVREGDEQRTF FSFPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRHGVSHKVDDSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTPH TATLRDRDSMRQIRAEISELPSIVQDLANGNITWADVE ARYPLFEGQETGKK |
Gene Name | GARS glycyl-tRNA synthetase [ Homo sapiens ] |
Official Symbol | GARS |
Synonyms | GARS; glycyl-tRNA synthetase; Charcot Marie Tooth neuropathy 2D , CMT2D; DSMAV; glycine tRNA ligase; GlyRS; SMAD1; |
Gene ID | 2617 |
mRNA Refseq | NM_002047 |
Protein Refseq | NP_002038 |
MIM | 600287 |
Uniprot ID | P41250 |
Chromosome Location | 7p15 |
Pathway | Aminoacyl-tRNA biosynthesis, organism-specific biosystem; Aminoacyl-tRNA biosynthesis, conserved biosystem; Aminoacyl-tRNA biosynthesis, eukaryotes, organism-specific biosystem; Aminoacyl-tRNA biosynthesis, eukaryotes, conserved biosystem; Cytosolic tRNA aminoacylation, organism-specific biosystem; |
Function | ATP binding; glycine-tRNA ligase activity; glycine-tRNA ligase activity; ligase activity; nucleotide binding; |
◆ Recombinant Proteins | ||
GARS-263H | Recombinant Human GARS, His-tagged | +Inquiry |
GARS-4730H | Recombinant Human GARS Protein, His-tagged | +Inquiry |
GARS-3470M | Recombinant Mouse GARS Protein, His (Fc)-Avi-tagged | +Inquiry |
Gars-3154M | Recombinant Mouse Gars Protein, Myc/DDK-tagged | +Inquiry |
GARS-3155C | Recombinant Chicken GARS | +Inquiry |
◆ Cell & Tissue Lysates | ||
GARS-6020HCL | Recombinant Human GARS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GARS Products
Required fields are marked with *
My Review for All GARS Products
Required fields are marked with *
0
Inquiry Basket