Recombinant Human GART protein, His-tagged
Cat.No. : | GART-4265H |
Product Overview : | Recombinant Human GART protein(P22102)(111–318aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 111–318aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 26.5 kDa |
AA Sequence : | KEFMDRHGIPTAQWKAFTKPEEACSFILSADFPALVVKASGLAAGKGVIVAKSKEEACKAVQEIMQEKAFGAAGETIVIEELLDGEEVSCLCFTDGKTVAPMPPAQDHKRLLEGDGGPNTGGMGAYCPAPQVSNDLLLKIKDTVLQRTVDGMQQEGTPYTGILYAGIMLTKNGPKVLEFNCRFGDPECQVILPLLKSDLYEVIQSTLD |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | GART phosphoribosylglycinamide formyltransferase, phosphoribosylglycinamide synthetase, phosphoribosylaminoimidazole synthetase [ Homo sapiens ] |
Official Symbol | GART |
Synonyms | GART; phosphoribosylglycinamide formyltransferase, phosphoribosylglycinamide synthetase, phosphoribosylaminoimidazole synthetase; PGFT, PRGS; trifunctional purine biosynthetic protein adenosine-3; AIRS; GARS; PAIS; PGFT; PRGS; GARTF; MGC47764; |
Gene ID | 2618 |
mRNA Refseq | NM_000819 |
Protein Refseq | NP_000810 |
MIM | 138440 |
UniProt ID | P22102 |
◆ Recombinant Proteins | ||
GART-6212M | Recombinant Mouse GART Protein | +Inquiry |
GART-26H | Recombinant Human GART Protein, MYC/DDK-tagged | +Inquiry |
GART-9156Z | Recombinant Zebrafish GART | +Inquiry |
GART-4732H | Recombinant Human GART Protein, GST-tagged | +Inquiry |
GART-1112C | Recombinant Chicken GART | +Inquiry |
◆ Cell & Tissue Lysates | ||
GART-687HCL | Recombinant Human GART cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GART Products
Required fields are marked with *
My Review for All GART Products
Required fields are marked with *
0
Inquiry Basket