Recombinant Human GAS2L2 Protein, GST-tagged
Cat.No. : | GAS2L2-4737H |
Product Overview : | Human GAS2L2 partial ORF ( NP_644814, 665 a.a. - 776 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene appears to crosslink microtubules and microfilaments and may be part of the cytoskeleton. This gene is mainly expressed in skeletal muscle. [provided by RefSeq, Jul 2011] |
Molecular Mass : | 38.06 kDa |
AA Sequence : | LLKVDLEAWKAAPTGSPKPAVTPGPGSLKGKLGARQSGPRTKASLSAKGTHMRKVPPQGGQDCSASTVSASPEAPTPSPLDPNSDKAKACLSKGRRTLRKPKRVPSIYKLKL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GAS2L2 growth arrest specific 2 like 2 [ Homo sapiens (human) ] |
Official Symbol | GAS2L2 |
Synonyms | GAS2L2; growth arrest specific 2 like 2; GAR17; GAS2-like protein 2; GAS2-related protein on chromosome 17 |
Gene ID | 246176 |
mRNA Refseq | NM_139285 |
Protein Refseq | NP_644814 |
MIM | 611398 |
UniProt ID | Q8NHY3 |
◆ Recombinant Proteins | ||
GAS2L2-3475M | Recombinant Mouse GAS2L2 Protein, His (Fc)-Avi-tagged | +Inquiry |
GAS2L2-6216M | Recombinant Mouse GAS2L2 Protein | +Inquiry |
GAS2L2-4737H | Recombinant Human GAS2L2 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GAS2L2 Products
Required fields are marked with *
My Review for All GAS2L2 Products
Required fields are marked with *