Recombinant Human GAS2L2 Protein, GST-tagged
| Cat.No. : | GAS2L2-4737H |
| Product Overview : | Human GAS2L2 partial ORF ( NP_644814, 665 a.a. - 776 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene appears to crosslink microtubules and microfilaments and may be part of the cytoskeleton. This gene is mainly expressed in skeletal muscle. [provided by RefSeq, Jul 2011] |
| Molecular Mass : | 38.06 kDa |
| AA Sequence : | LLKVDLEAWKAAPTGSPKPAVTPGPGSLKGKLGARQSGPRTKASLSAKGTHMRKVPPQGGQDCSASTVSASPEAPTPSPLDPNSDKAKACLSKGRRTLRKPKRVPSIYKLKL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GAS2L2 growth arrest specific 2 like 2 [ Homo sapiens (human) ] |
| Official Symbol | GAS2L2 |
| Synonyms | GAS2L2; growth arrest specific 2 like 2; GAR17; GAS2-like protein 2; GAS2-related protein on chromosome 17 |
| Gene ID | 246176 |
| mRNA Refseq | NM_139285 |
| Protein Refseq | NP_644814 |
| MIM | 611398 |
| UniProt ID | Q8NHY3 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GAS2L2 Products
Required fields are marked with *
My Review for All GAS2L2 Products
Required fields are marked with *
