Recombinant Human GAS2L2 Protein, GST-tagged

Cat.No. : GAS2L2-4737H
Product Overview : Human GAS2L2 partial ORF ( NP_644814, 665 a.a. - 776 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene appears to crosslink microtubules and microfilaments and may be part of the cytoskeleton. This gene is mainly expressed in skeletal muscle. [provided by RefSeq, Jul 2011]
Molecular Mass : 38.06 kDa
AA Sequence : LLKVDLEAWKAAPTGSPKPAVTPGPGSLKGKLGARQSGPRTKASLSAKGTHMRKVPPQGGQDCSASTVSASPEAPTPSPLDPNSDKAKACLSKGRRTLRKPKRVPSIYKLKL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GAS2L2 growth arrest specific 2 like 2 [ Homo sapiens (human) ]
Official Symbol GAS2L2
Synonyms GAS2L2; growth arrest specific 2 like 2; GAR17; GAS2-like protein 2; GAS2-related protein on chromosome 17
Gene ID 246176
mRNA Refseq NM_139285
Protein Refseq NP_644814
MIM 611398
UniProt ID Q8NHY3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GAS2L2 Products

Required fields are marked with *

My Review for All GAS2L2 Products

Required fields are marked with *

0
cart-icon