Recombinant Human GAS6
Cat.No. : | GAS6-28979TH |
Product Overview : | Recombinant fragment of Human GAS 6 with N terminal proprietary tag, 36.63kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene product is a gamma-carboxyglutamic acid (Gla)-containing protein thought to be involved in the stimulation of cell proliferation, and may play a role in thrombosis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Molecular Weight : | 36.630kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris buffered saline |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | VSLRDGEATLEVDGTRGQSEVSAAQLQERLAVLERHLRSPVLTFAGGLPDVPVTSAPVTAFYRGCMTLEVNRRLLDLDEAAYKHSDITAHSCPPVEPAAA |
Gene Name | GAS6 growth arrest-specific 6 [ Homo sapiens ] |
Official Symbol | GAS6 |
Synonyms | GAS6; growth arrest-specific 6; AXLLG; growth arrest-specific protein 6; AXL stimulatory factor; AXSF; DKFZp666G247; FLJ34709; |
Gene ID | 2621 |
mRNA Refseq | NM_000820 |
Protein Refseq | NP_000811 |
MIM | 600441 |
Uniprot ID | Q14393 |
Chromosome Location | 13q34 |
Pathway | Cell surface interactions at the vascular wall, organism-specific biosystem; Gamma-carboxylation of protein precursors, organism-specific biosystem; Gamma-carboxylation, transport, and amino-terminal cleavage of proteins, organism-specific biosystem; Hemostasis, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; |
Function | calcium ion binding; receptor agonist activity; receptor binding; |
◆ Recombinant Proteins | ||
GAS6-288TH | Recombinant Human GAS6 full-length, GST-tagged | +Inquiry |
GAS6-546H | Active Recombinant Human GAS6 Protein(Leu136~Phe311), His-tagged | +Inquiry |
Gas6-198R | Recombinant Gas6 TRIM21 Protein, His-tagged | +Inquiry |
GAS6-6218M | Recombinant Mouse GAS6 Protein | +Inquiry |
Gas6-196M | Recombinant Mouse Gas6 Protein, His/GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GAS6-6017HCL | Recombinant Human GAS6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GAS6 Products
Required fields are marked with *
My Review for All GAS6 Products
Required fields are marked with *