Recombinant Human GAS6

Cat.No. : GAS6-28979TH
Product Overview : Recombinant fragment of Human GAS 6 with N terminal proprietary tag, 36.63kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This gene product is a gamma-carboxyglutamic acid (Gla)-containing protein thought to be involved in the stimulation of cell proliferation, and may play a role in thrombosis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Molecular Weight : 36.630kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris buffered saline
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : VSLRDGEATLEVDGTRGQSEVSAAQLQERLAVLERHLRSPVLTFAGGLPDVPVTSAPVTAFYRGCMTLEVNRRLLDLDEAAYKHSDITAHSCPPVEPAAA
Gene Name GAS6 growth arrest-specific 6 [ Homo sapiens ]
Official Symbol GAS6
Synonyms GAS6; growth arrest-specific 6; AXLLG; growth arrest-specific protein 6; AXL stimulatory factor; AXSF; DKFZp666G247; FLJ34709;
Gene ID 2621
mRNA Refseq NM_000820
Protein Refseq NP_000811
MIM 600441
Uniprot ID Q14393
Chromosome Location 13q34
Pathway Cell surface interactions at the vascular wall, organism-specific biosystem; Gamma-carboxylation of protein precursors, organism-specific biosystem; Gamma-carboxylation, transport, and amino-terminal cleavage of proteins, organism-specific biosystem; Hemostasis, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem;
Function calcium ion binding; receptor agonist activity; receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GAS6 Products

Required fields are marked with *

My Review for All GAS6 Products

Required fields are marked with *

0
cart-icon