Recombinant Human GAS6
| Cat.No. : | GAS6-28979TH |
| Product Overview : | Recombinant fragment of Human GAS 6 with N terminal proprietary tag, 36.63kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 100 amino acids |
| Description : | This gene product is a gamma-carboxyglutamic acid (Gla)-containing protein thought to be involved in the stimulation of cell proliferation, and may play a role in thrombosis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris buffered saline |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | VSLRDGEATLEVDGTRGQSEVSAAQLQERLAVLERHLRSPVLTFAGGLPDVPVTSAPVTAFYRGCMTLEVNRRLLDLDEAAYKHSDITAHSCPPVEPAAA |
| Gene Name | GAS6 growth arrest-specific 6 [ Homo sapiens ] |
| Official Symbol | GAS6 |
| Synonyms | GAS6; growth arrest-specific 6; AXLLG; growth arrest-specific protein 6; AXL stimulatory factor; AXSF; DKFZp666G247; FLJ34709; |
| Gene ID | 2621 |
| mRNA Refseq | NM_000820 |
| Protein Refseq | NP_000811 |
| MIM | 600441 |
| Uniprot ID | Q14393 |
| Chromosome Location | 13q34 |
| Pathway | Cell surface interactions at the vascular wall, organism-specific biosystem; Gamma-carboxylation of protein precursors, organism-specific biosystem; Gamma-carboxylation, transport, and amino-terminal cleavage of proteins, organism-specific biosystem; Hemostasis, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; |
| Function | calcium ion binding; receptor agonist activity; receptor binding; |
| ◆ Recombinant Proteins | ||
| GAS6-623H | Active Recombinant Human GAS6, His-tagged | +Inquiry |
| GAS6-3479M | Recombinant Mouse GAS6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GAS6-6218M | Recombinant Mouse GAS6 Protein | +Inquiry |
| Gas6-1563R | Recombinant Rat Gas6 Protein, His&GST-tagged | +Inquiry |
| Gas6-8334M | Active Recombinant Mouse Gas6 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GAS6-6017HCL | Recombinant Human GAS6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GAS6 Products
Required fields are marked with *
My Review for All GAS6 Products
Required fields are marked with *
