Recombinant Human GAST Protein, GST-tagged

• Cat.No.: GAST-4742H
• Product Overview: Human GAST full-length ORF ( NP_000796.1, 1 a.a. - 101 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Gastrin is a hormone whose main function is to stimulate secretion of hydrochloric acid by the gastric mucosa, which results in gastrin formation inhibition. This hormone also acts as a mitogenic factor for gastrointestinal epithelial cells. Gastrin has two biologically active peptide forms, G34 and G17. [provided by RefSeq
• Molecular Mass: 37.8 kDa
• AA Sequence: MQRLCVYVLIFALALAAFSEASWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDFGRRSAEDEN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GAST gastrin [ Homo sapiens ]
• Official Symbol: GAST
• Synonyms: GAST; gastrin; GAS
• Gene ID: 2520
• mRNA Refseq: NM_000805
• Protein Refseq: NP_000796
• MIM: 137250
• UniProt ID: P01350