Recombinant Human GAST Protein, GST-tagged
Cat.No. : | GAST-4742H |
Product Overview : | Human GAST full-length ORF ( NP_000796.1, 1 a.a. - 101 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Gastrin is a hormone whose main function is to stimulate secretion of hydrochloric acid by the gastric mucosa, which results in gastrin formation inhibition. This hormone also acts as a mitogenic factor for gastrointestinal epithelial cells. Gastrin has two biologically active peptide forms, G34 and G17. [provided by RefSeq |
Molecular Mass : | 37.8 kDa |
AA Sequence : | MQRLCVYVLIFALALAAFSEASWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDFGRRSAEDEN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GAST gastrin [ Homo sapiens ] |
Official Symbol | GAST |
Synonyms | GAST; gastrin; GAS; |
Gene ID | 2520 |
mRNA Refseq | NM_000805 |
Protein Refseq | NP_000796 |
MIM | 137250 |
UniProt ID | P01350 |
◆ Recombinant Proteins | ||
GAST-13165H | Recombinant Human GAST, GST-tagged | +Inquiry |
Gast-5830R | Recombinant Rat Gast protein, His & GST-tagged | +Inquiry |
GAST-1487H | Active Recombinant Human GAST protein, Fc-Avi-tagged, Biotinylated | +Inquiry |
GAST-5459HF | Recombinant Full Length Human GAST Protein, GST-tagged | +Inquiry |
GAST-214H | Recombinant Human GAST | +Inquiry |
◆ Cell & Tissue Lysates | ||
GAST-6014HCL | Recombinant Human GAST 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GAST Products
Required fields are marked with *
My Review for All GAST Products
Required fields are marked with *