Recombinant Human GAST Protein, GST-tagged

Cat.No. : GAST-4742H
Product Overview : Human GAST full-length ORF ( NP_000796.1, 1 a.a. - 101 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Gastrin is a hormone whose main function is to stimulate secretion of hydrochloric acid by the gastric mucosa, which results in gastrin formation inhibition. This hormone also acts as a mitogenic factor for gastrointestinal epithelial cells. Gastrin has two biologically active peptide forms, G34 and G17. [provided by RefSeq
Molecular Mass : 37.8 kDa
AA Sequence : MQRLCVYVLIFALALAAFSEASWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDFGRRSAEDEN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GAST gastrin [ Homo sapiens ]
Official Symbol GAST
Synonyms GAST; gastrin; GAS;
Gene ID 2520
mRNA Refseq NM_000805
Protein Refseq NP_000796
MIM 137250
UniProt ID P01350

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GAST Products

Required fields are marked with *

My Review for All GAST Products

Required fields are marked with *

0
cart-icon
0
compare icon