Recombinant Human GATM
| Cat.No. : | GATM-28986TH |
| Product Overview : | Recombinant fragment of Human GATM with an N-terminal proprietary tag; Predicted MW 36.63kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 100 amino acids |
| Description : | This gene encodes a mitochondrial enzyme that belongs to the amidinotransferase family. This enzyme is involved in creatine biosynthesis, whereby it catalyzes the transfer of a guanido group from L-arginine to glycine, resulting in guanidinoacetic acid, the immediate precursor of creatine. Mutations in this gene cause arginine:glycine amidinotransferase deficiency, an inborn error of creatine synthesis characterized by mental retardation, language impairment, and behavioral disorders. |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Tissue specificity : | Expressed in brain, heart, kidney, liver, lung, salivary gland and skeletal muscle tissue, with the highest expression in kidney. Biallelically expressed in placenta and fetal tissues. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MLRVRCLRGGSRGAEAVHYIGSRLGRTLTGWVQRTFQSTQ AATASSRNSCAADDKATEPLPKDCPVSSYNEWDPLEEVIV GRAENACVPPFTIEVKANTY |
| Sequence Similarities : | Belongs to the amidinotransferase family. |
| Gene Name | GATM glycine amidinotransferase (L-arginine:glycine amidinotransferase) [ Homo sapiens ] |
| Official Symbol | GATM |
| Synonyms | GATM; glycine amidinotransferase (L-arginine:glycine amidinotransferase); glycine amidinotransferase, mitochondrial; AGAT; |
| Gene ID | 2628 |
| mRNA Refseq | NM_001482 |
| Protein Refseq | NP_001473 |
| MIM | 602360 |
| Uniprot ID | P50440 |
| Chromosome Location | 15q15.1 |
| Pathway | Arginine and proline metabolism, organism-specific biosystem; Arginine and proline metabolism, conserved biosystem; Creatine metabolism, organism-specific biosystem; Creatine pathway, organism-specific biosystem; Creatine pathway, conserved biosystem; |
| Function | glycine amidinotransferase activity; glycine amidinotransferase activity; transferase activity; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GATM Products
Required fields are marked with *
My Review for All GATM Products
Required fields are marked with *
