Recombinant Human GBA3 Protein, GST-tagged
Cat.No. : | GBA3-4768H |
Product Overview : | Human GBA3 full-length ORF (BAG36006.1, 1 a.a. - 469 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | GBA3, or cytosolic beta-glucosidase (EC 3.2.1.21), is a predominantly liver enzyme that efficiently hydrolyzes beta-D-glucoside and beta-D-galactoside, but not any known physiologic beta-glycoside, suggesting that it may be involved in detoxification of plant glycosides (de Graaf et al., 2001 [PubMed 11389701]). GBA3 also has significant neutral glycosylceramidase activity (EC 3.2.1.62), suggesting that it may be involved in a nonlysosomal catabolic pathway of glucosylceramide metabolism (Hayashi et al., 2007 [PubMed 17595169]).[supplied by OMIM |
Molecular Mass : | 77.99 kDa |
AA Sequence : | MAFPAGFGWAAATAAYQVEGGWDADGKGPCVWDTFTHQGGERVFKNQTGDVACGSYTLWEEDLKCIKQLGLTHYRFSLSWSRLLPDGTTGFINQKGIDYYNKIIDDLLKNGVTPIVTLYHFDLPQTLEDQGGWLSEAIIESFDKYAQFCFSTFGDRVKQWITINEANVLSVMSYDLGMFPPGIPHFGTGGYQAAHNLIKAHARSWHSYDSLFRKKQKGMVSLSLFAVWLEPADPNSVSDQEAAKRAITFHLDLFAKPIFIDGDYPEVVKSQIASMSQKQGYPSSRLPEFTEEEKKMIKGTADFFAVQYYTTRLIKYQENKKGELGILQDAEIEFFPDPSWKNVDWIYVVPWGVCKLLKYIKDTYNNPVIYITENGFPQSDPAPLDDTQRWEYFRQTFQELFKAIQLDKVNLQVYCAWSLLDNFEWNQGYSSRFGLFHVDFEDPARPRVPYTSAKEYAKIIRNNGLEAHL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GBA3 glucosidase, beta, acid 3 (cytosolic) [ Homo sapiens ] |
Official Symbol | GBA3 |
Synonyms | GBA3; glucosidase, beta, acid 3 (cytosolic); cytosolic beta-glucosidase; GLUC; klotho related protein; KLrP; klotho-related protein; cytosolic beta-glucosidase-like protein 1; CBGL1; MGC104276; MGC126878; |
Gene ID | 57733 |
mRNA Refseq | NM_001128432 |
Protein Refseq | NP_001121904 |
MIM | 606619 |
UniProt ID | Q9H227 |
◆ Recombinant Proteins | ||
GBA3-2855Z | Recombinant Zebrafish GBA3 | +Inquiry |
GBA3-4768H | Recombinant Human GBA3 Protein, GST-tagged | +Inquiry |
GBA3-5518HF | Recombinant Full Length Human GBA3 Protein, GST-tagged | +Inquiry |
GBA3-626H | Recombinant Human glucosidase, beta, acid 3, His-tagged | +Inquiry |
GBA3-1327H | Recombinant Human GBA3 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GBA3-661HCL | Recombinant Human GBA3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GBA3 Products
Required fields are marked with *
My Review for All GBA3 Products
Required fields are marked with *
0
Inquiry Basket