Recombinant Human GBE1

Cat.No. : GBE1-28989TH
Product Overview : Recombinant fragment of Human GBE1 (aa 605-702) with a N terminal proprietary tag: predicted molecular weight 36.41 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 98 amino acids
Description : The protein encoded by this gene is a glycogen branching enzyme that catalyzes the transfer of alpha-1,4-linked glucosyl units from the outer end of a glycogen chain to an alpha-1,6 position on the same or a neighboring glycogen chain. Branching of the chains is essential to increase the solubility of the glycogen molecule and, consequently, in reducing the osmotic pressure within cells. Highest level of this enzyme are found in liver and muscle. Mutations in this gene are associated with glycogen storage disease IV (also known as Andersens disease).
Molecular Weight : 36.410kDa inclusive of tags
Tissue specificity : Highest levels found in liver and muscle.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SEKHEGNKIIAFERAGLLFIFNFHPSKSYTDYRVGTALPGKFKIVLDSDAAEYGGHQRLDHSTDFFSEAFEHNGRPYSLLVYIPSRVALILQNVDLPN
Sequence Similarities : Belongs to the glycosyl hydrolase 13 family.
Gene Name GBE1 glucan (1,4-alpha-), branching enzyme 1 [ Homo sapiens ]
Official Symbol GBE1
Synonyms GBE1; glucan (1,4-alpha-), branching enzyme 1; 1,4-alpha-glucan-branching enzyme; Andersen disease; glycogen branching enzyme; glycogen storage disease type IV;
Gene ID 2632
mRNA Refseq NM_000158
Protein Refseq NP_000149
MIM 607839
Uniprot ID Q04446
Chromosome Location 3
Pathway Glucose metabolism, organism-specific biosystem; Glycogen Metabolism, organism-specific biosystem; Glycogen synthesis, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism of carbohydrates, organism-specific biosystem;
Function 1,4-alpha-glucan branching enzyme activity; cation binding; hydrolase activity, hydrolyzing O-glycosyl compounds; transferase activity, transferring glycosyl groups;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GBE1 Products

Required fields are marked with *

My Review for All GBE1 Products

Required fields are marked with *

0
cart-icon
0
compare icon