Recombinant Human GCG Protein, His-tagged

Cat.No. : GCG-4969H
Product Overview : GLP-1 (7-37) (HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG) K34R mutant peptide with His tag expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 7-37 a.a.
Description : The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon. [provided by RefSeq
Form : Lyophilized
Molecular Mass : 3.38 kDa
Purity : >= 90% by RP-HPLC
Applications : SDS-PAGE
Storage : Store at -20 centigrade. After reconstitution with ddH2O, store at -20 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : Lyophilized from ddH2O with no additives
Gene Name GCG glucagon [ Homo sapiens ]
Official Symbol GCG
Synonyms GCG; glucagon; glicentin related polypeptide; GLP1; GLP2; glucagon like peptide 1; glucagon like peptide 2; GRPP; glucagon-like peptide 1; glucagon-like peptide 2; glicentin-related polypeptide;
Gene ID 2641
mRNA Refseq NM_002054
Protein Refseq NP_002045
MIM 138030
UniProt ID P01275

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GCG Products

Required fields are marked with *

My Review for All GCG Products

Required fields are marked with *

0
cart-icon