Recombinant Human GCG Protein, His-tagged
Cat.No. : | GCG-4969H |
Product Overview : | GLP-1 (7-37) (HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG) K34R mutant peptide with His tag expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 7-37 a.a. |
Description : | The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon. [provided by RefSeq |
Form : | Lyophilized |
Molecular Mass : | 3.38 kDa |
Purity : | >= 90% by RP-HPLC |
Applications : | SDS-PAGE |
Storage : | Store at -20 centigrade. After reconstitution with ddH2O, store at -20 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | Lyophilized from ddH2O with no additives |
Gene Name | GCG glucagon [ Homo sapiens ] |
Official Symbol | GCG |
Synonyms | GCG; glucagon; glicentin related polypeptide; GLP1; GLP2; glucagon like peptide 1; glucagon like peptide 2; GRPP; glucagon-like peptide 1; glucagon-like peptide 2; glicentin-related polypeptide; |
Gene ID | 2641 |
mRNA Refseq | NM_002054 |
Protein Refseq | NP_002045 |
MIM | 138030 |
UniProt ID | P01275 |
◆ Recombinant Proteins | ||
GCG-295H | Recombinant Human Glucagon | +Inquiry |
GCG-370H | Synthetic Human Glucagon | +Inquiry |
GCG-3044H | Recombinant Human GCG Protein (Arg21-Lys180), N-His tagged | +Inquiry |
GCG-20H | Recombinant Human GCG protein, His-tagged | +Inquiry |
GCG-4104C | Recombinant Chicken GCG | +Inquiry |
◆ Cell & Tissue Lysates | ||
GCG-5990HCL | Recombinant Human GCG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GCG Products
Required fields are marked with *
My Review for All GCG Products
Required fields are marked with *