Recombinant Human GCG Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | GCG-1451H |
Product Overview : | GCG MS Standard C13 and N15-labeled recombinant protein (NP_002045) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon. |
Molecular Mass : | 20.9 kDa |
AA Sequence : | MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | GCG glucagon [ Homo sapiens (human) ] |
Official Symbol | GCG |
Synonyms | GCG; glucagon; glicentin related polypeptide; GLP1; GLP2; glucagon like peptide 1; glucagon like peptide 2; GRPP; glucagon-like peptide 1; glucagon-like peptide 2; glicentin-related polypeptide; |
Gene ID | 2641 |
mRNA Refseq | NM_002054 |
Protein Refseq | NP_002045 |
MIM | 138030 |
UniProt ID | P01275 |
◆ Recombinant Proteins | ||
GCG-3044H | Recombinant Human GCG Protein (Arg21-Lys180), N-His tagged | +Inquiry |
GCG-1451H | Recombinant Human GCG Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GCG-20H | Recombinant Human GCG protein, His-tagged | +Inquiry |
Gcg-6745R | Recombinant Rat Gcg protein, His-tagged | +Inquiry |
Gcg-3173M | Recombinant Mouse Gcg Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GCG-5990HCL | Recombinant Human GCG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GCG Products
Required fields are marked with *
My Review for All GCG Products
Required fields are marked with *