Recombinant Human GDF7 protein
| Cat.No. : | GDF7-28992TH |
| Product Overview : | Recombinant Human GDF7 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 129 |
| Description : | Growth/differentiation factors (GDF-1 to GDF-15) are members of the BMP family of TGF-beta superfamily proteins. They are produced as inactive preproproteins which are then cleaved and assembled into active secreted homodimers. GDF dimers are disulfide-linked with the exception of GDF-3 and -9. GDF proteins are important during embryonic development, particularly in the skeletal, nervous, and muscular systems. |
| Form : | Lyophilized from a 0.2μm filtered concentrated solution in 30 % Acetonitrile and 0.1 % TFA. |
| Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by inducing alkaline phosphatase production of murine ATDC5 cells is less than 1.0 μg/ml, corresponding to a specific activity of > 1000 IU/mg. |
| Molecular Mass : | Approximately 28.0 kDa, a disulfide-linked homodimeric protein containing two 129 amino acids. |
| AA Sequence : | TALAGTRTAQGSGGGAGRGHGRRGRSRCSRKPLHVDFKELGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLSPISILYIDAANNVVYKQYEDMVVEACGCR |
| Endotoxin : | Less than 0.1 EU/µg of rHuGDF-7/BMP-12 as determined by LAL method. |
| Purity : | >95% by SDS-PAGE and HPLC analysis. |
| Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
| Gene Name | GDF7 |
| Official Symbol | GDF7 |
| Synonyms | GDF7; growth differentiation factor 7; growth/differentiation factor 7; BMP12; GDF-7; |
| Gene ID | 151449 |
| mRNA Refseq | NM_182828 |
| Protein Refseq | NP_878248 |
| MIM | 604651 |
| UniProt ID | Q7Z4P5 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GDF7 Products
Required fields are marked with *
My Review for All GDF7 Products
Required fields are marked with *
