Recombinant Human GDI2

Cat.No. : GDI2-28229TH
Product Overview : Recombinant fragment of Human GDI2 with N terminal proprietary tag; Predicted MWt 36.63 kDa including the tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : GDP dissociation inhibitors are proteins that regulate the GDP-GTP exchange reaction of members of the rab family, small GTP-binding proteins of the ras superfamily, that are involved in vesicular trafficking of molecules between cellular organelles. GDIs slow the rate of dissociation of GDP from rab proteins and release GDP from membrane-bound rabs. GDI2 is ubiquitously expressed. The GDI2 gene contains many repetitive elements indicating that it may be prone to inversion/deletion rearrangements. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Ubiquitous.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : QGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNIYKRMTGSEFDFEEMKRKKNDIYGED
Sequence Similarities : Belongs to the Rab GDI family.
Gene Name GDI2 GDP dissociation inhibitor 2 [ Homo sapiens ]
Official Symbol GDI2
Synonyms GDI2; GDP dissociation inhibitor 2; rab GDP dissociation inhibitor beta; rab GDP dissociation; RABGDIB;
Gene ID 2665
mRNA Refseq NM_001115156
Protein Refseq NP_001108628
MIM 600767
Uniprot ID P50395
Chromosome Location 10p15
Pathway Rho GTPase cycle, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signaling by Rho GTPases, organism-specific biosystem;
Function GTPase activator activity; Rab GDP-dissociation inhibitor activity; Rab GTPase activator activity; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GDI2 Products

Required fields are marked with *

My Review for All GDI2 Products

Required fields are marked with *

0
cart-icon