Recombinant Human GDI2
| Cat.No. : | GDI2-28229TH |
| Product Overview : | Recombinant fragment of Human GDI2 with N terminal proprietary tag; Predicted MWt 36.63 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 100 amino acids |
| Description : | GDP dissociation inhibitors are proteins that regulate the GDP-GTP exchange reaction of members of the rab family, small GTP-binding proteins of the ras superfamily, that are involved in vesicular trafficking of molecules between cellular organelles. GDIs slow the rate of dissociation of GDP from rab proteins and release GDP from membrane-bound rabs. GDI2 is ubiquitously expressed. The GDI2 gene contains many repetitive elements indicating that it may be prone to inversion/deletion rearrangements. Alternative splicing results in multiple transcript variants encoding distinct isoforms. |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Tissue specificity : | Ubiquitous. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | QGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNIYKRMTGSEFDFEEMKRKKNDIYGED |
| Sequence Similarities : | Belongs to the Rab GDI family. |
| Gene Name | GDI2 GDP dissociation inhibitor 2 [ Homo sapiens ] |
| Official Symbol | GDI2 |
| Synonyms | GDI2; GDP dissociation inhibitor 2; rab GDP dissociation inhibitor beta; rab GDP dissociation; RABGDIB; |
| Gene ID | 2665 |
| mRNA Refseq | NM_001115156 |
| Protein Refseq | NP_001108628 |
| MIM | 600767 |
| Uniprot ID | P50395 |
| Chromosome Location | 10p15 |
| Pathway | Rho GTPase cycle, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signaling by Rho GTPases, organism-specific biosystem; |
| Function | GTPase activator activity; Rab GDP-dissociation inhibitor activity; Rab GTPase activator activity; protein binding; |
| ◆ Recombinant Proteins | ||
| GDI2-13214H | Recombinant Human GDI2, His-tagged | +Inquiry |
| GDI2-5246HF | Recombinant Full Length Human GDI2 Protein, GST-tagged | +Inquiry |
| GDI2-2603H | Recombinant Human GDI2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Gdi2-3183M | Recombinant Mouse Gdi2 Protein, Myc/DDK-tagged | +Inquiry |
| GDI2-2972H | Recombinant Human GDI2, T7-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GDI2-5964HCL | Recombinant Human GDI2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GDI2 Products
Required fields are marked with *
My Review for All GDI2 Products
Required fields are marked with *
