Recombinant Human GEMIN5 Protein, GST-tagged
| Cat.No. : | GEMIN5-4841H |
| Product Overview : | Human GEMIN5 partial ORF ( NP_056280.1, 401 a.a. - 510 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | GEMIN5 is part of a large macromolecular complex localized to both the cytoplasm and the nucleus that plays a role in the cytoplasmic assembly of small nuclear ribonucleoproteins (snRNPs). Other members of this complex include SMN (MIM 600354), GEMIN2 (SIP1; MIM 602595), GEMIN3 (DDX20; MIM 606168), and GEMIN4 (MIM 606969).[supplied by OMIM |
| Molecular Mass : | 37.84 kDa |
| AA Sequence : | DGMIRVWNTLSIKNNYDVKNFWQGVKSKVTALCWHPTKEGCLAFGTDDGKVGLYDTYSNKPPQISSTYHKKTVYTLAWGPPVPPMSLGGEGDRPSLALYSCGGEGIVLQH |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GEMIN5 gem (nuclear organelle) associated protein 5 [ Homo sapiens ] |
| Official Symbol | GEMIN5 |
| Synonyms | GEMIN5; gem (nuclear organelle) associated protein 5; gem-associated protein 5; GEMIN-5; MGC142174; DKFZp586M1824; |
| Gene ID | 25929 |
| mRNA Refseq | NM_001252156 |
| Protein Refseq | NP_001239085 |
| MIM | 607005 |
| UniProt ID | Q8TEQ6 |
| ◆ Recombinant Proteins | ||
| GEMIN5-976H | Recombinant Human GEMIN5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Gemin5-3188M | Recombinant Mouse Gemin5 Protein, Myc/DDK-tagged | +Inquiry |
| GEMIN5-4841H | Recombinant Human GEMIN5 Protein, GST-tagged | +Inquiry |
| GEMIN5-5426H | Recombinant Human GEMIN5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| GEMIN5-367HFL | Active Recombinant Full Length Human GEMIN5 Protein, C-Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GEMIN5 Products
Required fields are marked with *
My Review for All GEMIN5 Products
Required fields are marked with *
