Recombinant Human GEMIN5 Protein, GST-tagged

Cat.No. : GEMIN5-4841H
Product Overview : Human GEMIN5 partial ORF ( NP_056280.1, 401 a.a. - 510 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : GEMIN5 is part of a large macromolecular complex localized to both the cytoplasm and the nucleus that plays a role in the cytoplasmic assembly of small nuclear ribonucleoproteins (snRNPs). Other members of this complex include SMN (MIM 600354), GEMIN2 (SIP1; MIM 602595), GEMIN3 (DDX20; MIM 606168), and GEMIN4 (MIM 606969).[supplied by OMIM
Molecular Mass : 37.84 kDa
AA Sequence : DGMIRVWNTLSIKNNYDVKNFWQGVKSKVTALCWHPTKEGCLAFGTDDGKVGLYDTYSNKPPQISSTYHKKTVYTLAWGPPVPPMSLGGEGDRPSLALYSCGGEGIVLQH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GEMIN5 gem (nuclear organelle) associated protein 5 [ Homo sapiens ]
Official Symbol GEMIN5
Synonyms GEMIN5; gem (nuclear organelle) associated protein 5; gem-associated protein 5; GEMIN-5; MGC142174; DKFZp586M1824;
Gene ID 25929
mRNA Refseq NM_001252156
Protein Refseq NP_001239085
MIM 607005
UniProt ID Q8TEQ6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GEMIN5 Products

Required fields are marked with *

My Review for All GEMIN5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon