Recombinant Human GEMIN5 Protein, GST-tagged

• Cat.No.: GEMIN5-4841H
• Product Overview: Human GEMIN5 partial ORF ( NP_056280.1, 401 a.a. - 510 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: GEMIN5 is part of a large macromolecular complex localized to both the cytoplasm and the nucleus that plays a role in the cytoplasmic assembly of small nuclear ribonucleoproteins (snRNPs). Other members of this complex include SMN (MIM 600354), GEMIN2 (SIP1; MIM 602595), GEMIN3 (DDX20; MIM 606168), and GEMIN4 (MIM 606969).[supplied by OMIM
• Molecular Mass: 37.84 kDa
• AA Sequence: DGMIRVWNTLSIKNNYDVKNFWQGVKSKVTALCWHPTKEGCLAFGTDDGKVGLYDTYSNKPPQISSTYHKKTVYTLAWGPPVPPMSLGGEGDRPSLALYSCGGEGIVLQH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GEMIN5 gem (nuclear organelle) associated protein 5 [ Homo sapiens ]
• Official Symbol: GEMIN5
• Synonyms: GEMIN5; gem (nuclear organelle) associated protein 5; gem-associated protein 5; GEMIN-5; MGC142174; DKFZp586M1824
• Gene ID: 25929
• mRNA Refseq: NM_001252156
• Protein Refseq: NP_001239085
• MIM: 607005
• UniProt ID: Q8TEQ6