Recombinant Human GFM2, His-tagged
Cat.No. : | GFM2-90H |
Product Overview : | Recombinant Human Ribosome-Releasing factor 2 Mitochondrial/GFM2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence of Human GFM2 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Description : | Ribosome-Rreleasing factor 2 Mitochondrial (GFM2) is a member of the GTP-binding elongation factor family. Mitochondrial GTPase that mediates the disassembly of ribosomes from messenger RNA at the termination of mitochondrial protein biosynthesis. But it is not involved in the GTP-dependent ribosomal translocation step during translation elongation. GFM2 is widely expressed in many tissues and localizes to the mitochondrion. The role of GFM2 in the regulation of normal mitochondrial function and in different disease states attributed to mitochondrial dysfunction is not known. Alternative splicing results in at least three known transcript variants encoding distinct isoforms. |
AA Sequence : | MLTNLRIFAMSHQTIPSVYINNICCYKIRASLKRLKPHVPLGRNCSSLPGLIGNDIKSLHSIINP PIAKIRNIGIMAHIDAGKTTTTERILYYSGYTRSLGDVDDGDTVTDFMAQERERGITIQSAAVTF DWKGYRVNLIDTPGHVDFTLEVERCLRVLDGAVAVFDASAGVEAQTLTVWRQADKHNIPRICFLN KMDKTGASFKYAVESIREKLKAKPLLLQLPIGEAKTFKGVVDVVMKEKLLWNCNSNDGKDFERKP LLEMNDPELLKETTEARNALIEQVADLDDEFADLVLEEFSENFDLLPAEKLQTAIHRVTLAQTAV PVLCGSALKNKGIQPLLDAVTMYLPSPEERNYEFLQWYKDDLCALAFKVLHDKQRGPLVFMRIYS GTIKPQLAIHNINGNCTERISRLLLPFADQHVEIPSLTAGNIALTVGLKHTATGDTIVSSKSSAL AAARRAEREGEKKHRQNNEAERLLLAGVEIPEPVFFCTIEPPSLSKQPDLEHALKCLQREDPSLK VRLDPDSGQTVLCGMGELHIEIIHDRIKREYGLETYLGPLQVAYRETILNSVRATDTLDRTLGDK RHLVTVEVEARPIETSSVMPVIEFEYAESINEGLLKVSQEAIENGIHSACLQGPLLGSPIQDVAI TLHSLTIHPGTSTTMISACVSRCVQKALKKADKQVLEPLMNLEVTVARDYLSPVLADLAQRRGNI QEIQTRQDNKVVIGFVPLAEIMGYSTVLRTLTSGSATFALELSTYQAMNPQDQNTLLNRRSGLTV DHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Gene Name | GFM2 G elongation factor, mitochondrial 2 [ Homo sapiens ] |
Official Symbol | GFM2 |
Synonyms | GFM2; G elongation factor, mitochondrial 2; ribosome-releasing factor 2, mitochondrial; EFG2; FLJ21661; MSTP027; mitochondrial elongation factor G2; elongation factor G 2, mitochondrial; mitochondrial ribosome recycling factor 2; RRF2; MRRF2; hEFG2; MST027; RRF2mt; EF-G2mt; mEF-G 2; |
Gene ID | 84340 |
mRNA Refseq | NM_032380 |
Protein Refseq | NP_115756 |
MIM | 606544 |
UniProt ID | Q969S9 |
Chromosome Location | 5q13 |
Function | GTP binding; GTPase activity; nucleotide binding; NOT translation elongation factor activity; |
◆ Recombinant Proteins | ||
GFM2-1731H | Recombinant Human GFM2 protein, His & T7-tagged | +Inquiry |
GFM2-13231H | Recombinant Human GFM2, GST-tagged | +Inquiry |
GFM2-90H | Recombinant Human GFM2, His-tagged | +Inquiry |
GFM2-5382HF | Recombinant Full Length Human GFM2 Protein, GST-tagged | +Inquiry |
GFM2-4854H | Recombinant Human GFM2 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GFM2 Products
Required fields are marked with *
My Review for All GFM2 Products
Required fields are marked with *