Recombinant Human GFOD1, His-tagged
Cat.No. : | GFOD1-91H |
Product Overview : | Recombinant Human Glucose-Fructose Oxidoreductase Domain-Containing Protein 1/GFOD1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Lys22-Cys390) of Human GFOD1 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 22-390 a.a. |
Description : | Glucose-Fructose Oxidoreductase Domain-Containing Protein 1 (GFOD1) is a member of the Gfo/Idh/MocA family. GFOD1 is a secreted protein and localizes to the extracellular region. GFOD1 has three spliced transcript isoforms. GFOD1 molecular has the nucleotide binding activity and oxidoreductase activity. |
AA Sequence : | KDEGFAVKALWGRTQEEAEELAKEMSVPFYTSRIDEVLLHQDVDLVCINLPPPLTRQIAVKTLGI GKNVICDRTATPLDAFRMTSAAHYYPKLMSIMGNVLRFLPAFVRMKQLIEEGYVGEPLVCEVQVH GGSLLGKKYNWSCDDLMGGGGLHSVGTYIIDLLTFLTGQKAVKVHGLLKTFVKQTDHIKGIRQIT SDDFCTFQMVLEGGVCCTVTLNFNVPGEFKQDVTVVGSAGRLLAVGTDLYGQRNSAPEQELLVQD ATPVSNSLLPEKAFSDIPSPYLRGTIKMMQAVRQAFQDQDDRRTWDGRPLTMAATFDDCLYALCV VDTIKRSSQTGEWQNIAIMTEEPELSPAYLISEAMRRSRMSLYCVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Gene Name | GFOD1 glucose-fructose oxidoreductase domain containing 1 [ Homo sapiens ] |
Official Symbol | GFOD1 |
Synonyms | GFOD1; glucose-fructose oxidoreductase domain containing 1; C6orf114, chromosome 6 open reading frame 114; glucose-fructose oxidoreductase domain-containing protein 1; ADG 90; FLJ20330; ADG-90; C6orf114; FLJ30569; MGC70653; RP11-501I19.1; |
Gene ID | 54438 |
mRNA Refseq | NM_001242628 |
Protein Refseq | NP_001229557 |
UniProt ID | Q9NXC2 |
Chromosome Location | 6pter-p22.1 |
Function | nucleotide binding; oxidoreductase activity; |
◆ Recombinant Proteins | ||
GFOD1-0102H | Recombinant Human GFOD1 Protein, GST-Tagged | +Inquiry |
GFOD1-1857H | Recombinant Human GFOD1 Protein, His-tagged | +Inquiry |
GFOD1-3258HF | Recombinant Full Length Human GFOD1 Protein, GST-tagged | +Inquiry |
GFOD1-1655R | Recombinant Rhesus Macaque GFOD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GFOD1-6313M | Recombinant Mouse GFOD1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GFOD1-696HCL | Recombinant Human GFOD1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GFOD1 Products
Required fields are marked with *
My Review for All GFOD1 Products
Required fields are marked with *