Recombinant Human GFOD1, His-tagged

Cat.No. : GFOD1-91H
Product Overview : Recombinant Human Glucose-Fructose Oxidoreductase Domain-Containing Protein 1/GFOD1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Lys22-Cys390) of Human GFOD1 fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 22-390 a.a.
Description : Glucose-Fructose Oxidoreductase Domain-Containing Protein 1 (GFOD1) is a member of the Gfo/Idh/MocA family. GFOD1 is a secreted protein and localizes to the extracellular region. GFOD1 has three spliced transcript isoforms. GFOD1 molecular has the nucleotide binding activity and oxidoreductase activity.
AA Sequence : KDEGFAVKALWGRTQEEAEELAKEMSVPFYTSRIDEVLLHQDVDLVCINLPPPLTRQIAVKTLGI GKNVICDRTATPLDAFRMTSAAHYYPKLMSIMGNVLRFLPAFVRMKQLIEEGYVGEPLVCEVQVH GGSLLGKKYNWSCDDLMGGGGLHSVGTYIIDLLTFLTGQKAVKVHGLLKTFVKQTDHIKGIRQIT SDDFCTFQMVLEGGVCCTVTLNFNVPGEFKQDVTVVGSAGRLLAVGTDLYGQRNSAPEQELLVQD ATPVSNSLLPEKAFSDIPSPYLRGTIKMMQAVRQAFQDQDDRRTWDGRPLTMAATFDDCLYALCV VDTIKRSSQTGEWQNIAIMTEEPELSPAYLISEAMRRSRMSLYCVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name GFOD1 glucose-fructose oxidoreductase domain containing 1 [ Homo sapiens ]
Official Symbol GFOD1
Synonyms GFOD1; glucose-fructose oxidoreductase domain containing 1; C6orf114, chromosome 6 open reading frame 114; glucose-fructose oxidoreductase domain-containing protein 1; ADG 90; FLJ20330; ADG-90; C6orf114; FLJ30569; MGC70653; RP11-501I19.1;
Gene ID 54438
mRNA Refseq NM_001242628
Protein Refseq NP_001229557
UniProt ID Q9NXC2
Chromosome Location 6pter-p22.1
Function nucleotide binding; oxidoreductase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GFOD1 Products

Required fields are marked with *

My Review for All GFOD1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon