Recombinant Human GFOD2 Protein, GST-tagged
| Cat.No. : | GFOD2-4857H |
| Product Overview : | Human GFOD2 full-length ORF ( AAH00757.1, 1 a.a. - 280 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | GFOD2 (Glucose-Fructose Oxidoreductase Domain Containing 2) is a Protein Coding gene. GO annotations related to this gene include oxidoreductase activity. An important paralog of this gene is GFOD1. |
| Molecular Mass : | 57.3 kDa |
| AA Sequence : | MVTASRYYPQLMSLVGNVLRFLPAFVRMKQLISEHYVGAVMICDARIYSGSLLSPSYGWICDELMGGGGLHTMGTYIVDLLTHLTGRRAEKVHGLLKTFVRQNAAIRGIRHVTSDDFCFFQMLMGGGVCSTVTLNFNMPGAFVHEVMVVGSAGRLVARGADLYGQKNSATQEELLLRDSLAVGAGLPEQGPQDVPLLYLKGMVYMVQALRQSFQGQGDRRTWDRTPVSMAASFEDGLYMQSVVDAIKRSSRSGEWEAVEVLTEEPDTNQNLCEALQRNNL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GFOD2 glucose-fructose oxidoreductase domain containing 2 [ Homo sapiens ] |
| Official Symbol | GFOD2 |
| Synonyms | GFOD2; glucose-fructose oxidoreductase domain containing 2; glucose-fructose oxidoreductase domain-containing protein 2; FLJ23802; MGC11335; FLJ39316; |
| Gene ID | 81577 |
| mRNA Refseq | NM_001243650 |
| Protein Refseq | NP_001230579 |
| UniProt ID | Q3B7J2 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GFOD2 Products
Required fields are marked with *
My Review for All GFOD2 Products
Required fields are marked with *



