Recombinant Human GFOD2 Protein, GST-tagged

Cat.No. : GFOD2-4857H
Product Overview : Human GFOD2 full-length ORF ( AAH00757.1, 1 a.a. - 280 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : GFOD2 (Glucose-Fructose Oxidoreductase Domain Containing 2) is a Protein Coding gene. GO annotations related to this gene include oxidoreductase activity. An important paralog of this gene is GFOD1.
Molecular Mass : 57.3 kDa
AA Sequence : MVTASRYYPQLMSLVGNVLRFLPAFVRMKQLISEHYVGAVMICDARIYSGSLLSPSYGWICDELMGGGGLHTMGTYIVDLLTHLTGRRAEKVHGLLKTFVRQNAAIRGIRHVTSDDFCFFQMLMGGGVCSTVTLNFNMPGAFVHEVMVVGSAGRLVARGADLYGQKNSATQEELLLRDSLAVGAGLPEQGPQDVPLLYLKGMVYMVQALRQSFQGQGDRRTWDRTPVSMAASFEDGLYMQSVVDAIKRSSRSGEWEAVEVLTEEPDTNQNLCEALQRNNL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GFOD2 glucose-fructose oxidoreductase domain containing 2 [ Homo sapiens ]
Official Symbol GFOD2
Synonyms GFOD2; glucose-fructose oxidoreductase domain containing 2; glucose-fructose oxidoreductase domain-containing protein 2; FLJ23802; MGC11335; FLJ39316;
Gene ID 81577
mRNA Refseq NM_001243650
Protein Refseq NP_001230579
UniProt ID Q3B7J2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GFOD2 Products

Required fields are marked with *

My Review for All GFOD2 Products

Required fields are marked with *

0
cart-icon
0
compare icon