Recombinant Human GFOD2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : GFOD2-5508H
Product Overview : GFOD2 MS Standard C13 and N15-labeled recombinant protein (NP_110446) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : GFOD2 (Glucose-Fructose Oxidoreductase Domain Containing 2) is a Protein Coding gene. Diseases associated with GFOD2 include Maple Syrup Urine Disease. Gene Ontology (GO) annotations related to this gene include oxidoreductase activity. An important paralog of this gene is GFOD1.
Molecular Mass : 42.3 kDa
AA Sequence : MKMLPGVGVFGTGSSARVLVPLLRAEGFTVEALWGKTEEEAKQLAEEMNIAFYTSRTDDILLHQDVDLVCISIPPPLTRQISVKALGIGKNVVCEKAATSVDAFRMVTASRYYPQLMSLVGNVLRFLPAFVRMKQLISEHYVGAVMICDARIYSGSLLSPSYGWICDELMGGGGLHTMGTYIVDLLTHLTGRRAEKVHGLLKTFVRQNAAIRGIRHVTSDDFCFFQMLMGGGVCSTVTLNFNMPGAFVHEVMVVGSAGRLVARGADLYGQKNSATQEELLLRDSLAVGAGLPEQGPQDVPLLYLKGMVYMVQALRQSFQGQGDRRTWDRTPVSMAASFEDGLYMQSVVDAIKRSSRSGEWEAVEVLTEEPDTNQNLCEALQRNNLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name GFOD2 glucose-fructose oxidoreductase domain containing 2 [ Homo sapiens (human) ]
Official Symbol GFOD2
Synonyms GFOD2; glucose-fructose oxidoreductase domain containing 2; glucose-fructose oxidoreductase domain-containing protein 2; FLJ23802; MGC11335; FLJ39316;
Gene ID 81577
mRNA Refseq NM_030819
Protein Refseq NP_110446
UniProt ID Q3B7J2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GFOD2 Products

Required fields are marked with *

My Review for All GFOD2 Products

Required fields are marked with *

0
cart-icon
0
compare icon