Recombinant Human GFOD2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | GFOD2-5508H |
Product Overview : | GFOD2 MS Standard C13 and N15-labeled recombinant protein (NP_110446) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | GFOD2 (Glucose-Fructose Oxidoreductase Domain Containing 2) is a Protein Coding gene. Diseases associated with GFOD2 include Maple Syrup Urine Disease. Gene Ontology (GO) annotations related to this gene include oxidoreductase activity. An important paralog of this gene is GFOD1. |
Molecular Mass : | 42.3 kDa |
AA Sequence : | MKMLPGVGVFGTGSSARVLVPLLRAEGFTVEALWGKTEEEAKQLAEEMNIAFYTSRTDDILLHQDVDLVCISIPPPLTRQISVKALGIGKNVVCEKAATSVDAFRMVTASRYYPQLMSLVGNVLRFLPAFVRMKQLISEHYVGAVMICDARIYSGSLLSPSYGWICDELMGGGGLHTMGTYIVDLLTHLTGRRAEKVHGLLKTFVRQNAAIRGIRHVTSDDFCFFQMLMGGGVCSTVTLNFNMPGAFVHEVMVVGSAGRLVARGADLYGQKNSATQEELLLRDSLAVGAGLPEQGPQDVPLLYLKGMVYMVQALRQSFQGQGDRRTWDRTPVSMAASFEDGLYMQSVVDAIKRSSRSGEWEAVEVLTEEPDTNQNLCEALQRNNLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | GFOD2 glucose-fructose oxidoreductase domain containing 2 [ Homo sapiens (human) ] |
Official Symbol | GFOD2 |
Synonyms | GFOD2; glucose-fructose oxidoreductase domain containing 2; glucose-fructose oxidoreductase domain-containing protein 2; FLJ23802; MGC11335; FLJ39316; |
Gene ID | 81577 |
mRNA Refseq | NM_030819 |
Protein Refseq | NP_110446 |
UniProt ID | Q3B7J2 |
◆ Recombinant Proteins | ||
GFOD2-6314M | Recombinant Mouse GFOD2 Protein | +Inquiry |
GFOD2-5428HF | Recombinant Full Length Human GFOD2 Protein, GST-tagged | +Inquiry |
GFOD2-1835R | Recombinant Rhesus monkey GFOD2 Protein, His-tagged | +Inquiry |
GFOD2-4857H | Recombinant Human GFOD2 Protein, GST-tagged | +Inquiry |
Gfod2-1016M | Recombinant Mouse Gfod2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GFOD2-697HCL | Recombinant Human GFOD2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GFOD2 Products
Required fields are marked with *
My Review for All GFOD2 Products
Required fields are marked with *
0
Inquiry Basket