Recombinant Human GFRAL Protein (19-351 aa), His-SUMO-tagged
| Cat.No. : | GFRAL-1929H |
| Product Overview : | Recombinant Human GFRAL Protein (19-351 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 19-351 aa |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 53.8 kDa |
| AA Sequence : | SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGE |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Publications : |
Secreted GDF15 maintains transcriptional responses during DNA damage-mediated senescence in human beta cells (2024)
|
| Gene Name | GFRAL GDNF family receptor alpha like [ Homo sapiens ] |
| Official Symbol | GFRAL |
| Synonyms | GFRAL; bA360D14.1; GRAL; UNQ9356; IVFI9356; C6orf144; |
| Gene ID | 389400 |
| mRNA Refseq | NM_207410 |
| Protein Refseq | NP_997293 |
| UniProt ID | Q6UXV0 |
| ◆ Recombinant Proteins | ||
| GFRAL-1493H | Recombinant Human GFRAL protein, His-tagged | +Inquiry |
| GFRAL-002H | Recombinant Human GFRAL protein, His-tagged | +Inquiry |
| GFRAL-1929H | Recombinant Human GFRAL Protein (19-351 aa), His-SUMO-tagged | +Inquiry |
| Gfral-264M | Recombinant Mouse Gfral Protein, Gln20-Glu350, N-His-Avi tagged, Biotinylated | +Inquiry |
| Gfral-060M | Recombinant Mouse Gfral protein, His-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GFRAL Products
Required fields are marked with *
My Review for All GFRAL Products
Required fields are marked with *
