Recombinant Human GFRAL Protein (19-351 aa), His-SUMO-tagged

Cat.No. : GFRAL-1929H
Product Overview : Recombinant Human GFRAL Protein (19-351 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 19-351 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 53.8 kDa
AA Sequence : SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGE
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Publications :
Secreted GDF15 maintains transcriptional responses during DNA damage-mediated senescence in human beta cells (2024)
Gene Name GFRAL GDNF family receptor alpha like [ Homo sapiens ]
Official Symbol GFRAL
Synonyms GFRAL; bA360D14.1; GRAL; UNQ9356; IVFI9356; C6orf144;
Gene ID 389400
mRNA Refseq NM_207410
Protein Refseq NP_997293
UniProt ID Q6UXV0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GFRAL Products

Required fields are marked with *

My Review for All GFRAL Products

Required fields are marked with *

0
cart-icon
0
compare icon