Recombinant Human GFRAL Protein (19-351 aa), His-SUMO-tagged
Cat.No. : | GFRAL-1929H |
Product Overview : | Recombinant Human GFRAL Protein (19-351 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 19-351 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 53.8 kDa |
AA Sequence : | SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGE |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Publications : |
Secreted GDF15 maintains transcriptional responses during DNA damage-mediated senescence in human beta cells (2024)
|
Gene Name | GFRAL GDNF family receptor alpha like [ Homo sapiens ] |
Official Symbol | GFRAL |
Synonyms | GFRAL; bA360D14.1; GRAL; UNQ9356; IVFI9356; C6orf144; |
Gene ID | 389400 |
mRNA Refseq | NM_207410 |
Protein Refseq | NP_997293 |
UniProt ID | Q6UXV0 |
◆ Recombinant Proteins | ||
GFRAL-103H | Recombinant Human GFRAL Protein, Ser19-Glu351, C-His-Avi tagged, Biotinylated | +Inquiry |
GFRAL-5733H | Recombinant Human GFRAL protein, hFc-tagged | +Inquiry |
GFRAL-22H | Recombinant Human GFRAL Protein, His-tagged | +Inquiry |
Gfral-264M | Recombinant Mouse Gfral Protein, Gln20-Glu350, N-His-Avi tagged, Biotinylated | +Inquiry |
GFRAL-1929H | Recombinant Human GFRAL Protein (19-351 aa), His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GFRAL Products
Required fields are marked with *
My Review for All GFRAL Products
Required fields are marked with *
0
Inquiry Basket