Recombinant Human GGCX

Cat.No. : GGCX-29018TH
Product Overview : Recombinant fragment corresponding to amino acids 533-629 of Human GGCX with an N terminal proprietary tag; Predicted MWt 36.3 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 97 amino acids
Description : This gene encodes an enzyme which catalyzes the posttranslational modification of vitamin K-dependent protein. Many of these vitamin K-dependent proteins are involved in coagulation so the function of the encoded enzyme is essential for hemostasis. Mutations in this gene are associated with vitamin K-dependent coagulation defect and PXE-like disorder with multiple coagulation factor deficiency. Multiple transcript variants encoding different isoforms have been found for this gene.
Molecular Weight : 36.300kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : ADFPGLHLENFVSEDLGNTSIQLLQGEVTVELVAEQKNQTLREGEKMQLPAGEYHKVYTTSPSPSCYMYVYVNTTELALEQDLAYLQELKEKVENGS
Sequence Similarities : Belongs to the vitamin K-dependent gamma-carboxylase family.
Gene Name GGCX gamma-glutamyl carboxylase [ Homo sapiens ]
Official Symbol GGCX
Synonyms GGCX; gamma-glutamyl carboxylase; vitamin K-dependent gamma-carboxylase; vitamin K dependent gamma carboxylase; VKCFD1;
Gene ID 2677
mRNA Refseq NM_000821
Protein Refseq NP_000812
MIM 137167
Uniprot ID P38435
Chromosome Location 2p12
Pathway Gamma-carboxylation of protein precursors, organism-specific biosystem; Gamma-carboxylation, transport, and amino-terminal cleavage of proteins, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; Post-translational modification: gamma carboxylation and hypusine formation, organism-specific biosystem; Post-translational protein modification, organism-specific biosystem;
Function gamma-glutamyl carboxylase activity; lyase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GGCX Products

Required fields are marked with *

My Review for All GGCX Products

Required fields are marked with *

0
cart-icon