Recombinant Human GGCX
Cat.No. : | GGCX-29018TH |
Product Overview : | Recombinant fragment corresponding to amino acids 533-629 of Human GGCX with an N terminal proprietary tag; Predicted MWt 36.3 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 97 amino acids |
Description : | This gene encodes an enzyme which catalyzes the posttranslational modification of vitamin K-dependent protein. Many of these vitamin K-dependent proteins are involved in coagulation so the function of the encoded enzyme is essential for hemostasis. Mutations in this gene are associated with vitamin K-dependent coagulation defect and PXE-like disorder with multiple coagulation factor deficiency. Multiple transcript variants encoding different isoforms have been found for this gene. |
Molecular Weight : | 36.300kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | ADFPGLHLENFVSEDLGNTSIQLLQGEVTVELVAEQKNQTLREGEKMQLPAGEYHKVYTTSPSPSCYMYVYVNTTELALEQDLAYLQELKEKVENGS |
Sequence Similarities : | Belongs to the vitamin K-dependent gamma-carboxylase family. |
Gene Name | GGCX gamma-glutamyl carboxylase [ Homo sapiens ] |
Official Symbol | GGCX |
Synonyms | GGCX; gamma-glutamyl carboxylase; vitamin K-dependent gamma-carboxylase; vitamin K dependent gamma carboxylase; VKCFD1; |
Gene ID | 2677 |
mRNA Refseq | NM_000821 |
Protein Refseq | NP_000812 |
MIM | 137167 |
Uniprot ID | P38435 |
Chromosome Location | 2p12 |
Pathway | Gamma-carboxylation of protein precursors, organism-specific biosystem; Gamma-carboxylation, transport, and amino-terminal cleavage of proteins, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; Post-translational modification: gamma carboxylation and hypusine formation, organism-specific biosystem; Post-translational protein modification, organism-specific biosystem; |
Function | gamma-glutamyl carboxylase activity; lyase activity; |
◆ Cell & Tissue Lysates | ||
GGCX-5949HCL | Recombinant Human GGCX 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GGCX Products
Required fields are marked with *
My Review for All GGCX Products
Required fields are marked with *