Recombinant Human GGH protein(219-293aa), His-GST&Myc-tagged
| Cat.No. : | GGH-1331H |
| Product Overview : | Recombinant Human GGH protein(Q92820)(219-293aa), fused with N-terminal His and GST tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST&His&Myc |
| Protein Length : | 219-293aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 43.9 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | TNTDGKIEFISTMEGYKYPVYGVQWHPEKAPYEWKNLDGISHAPNAVKTAFYLAEFFVNEARKNNHHFKSESEEE |
| Gene Name | GGH gamma-glutamyl hydrolase (conjugase, folylpolygammaglutamyl hydrolase) [ Homo sapiens ] |
| Official Symbol | GGH |
| Synonyms | GGH; gamma-glutamyl hydrolase (conjugase, folylpolygammaglutamyl hydrolase); gamma-glutamyl hydrolase; gamma-Glu-X carboxypeptidase; GH; |
| Gene ID | 8836 |
| mRNA Refseq | NM_003878 |
| Protein Refseq | NP_003869 |
| MIM | 601509 |
| UniProt ID | Q92820 |
| ◆ Recombinant Proteins | ||
| GGH-3543M | Recombinant Mouse GGH Protein, His (Fc)-Avi-tagged | +Inquiry |
| GGH-1839R | Recombinant Rhesus monkey GGH Protein, His-tagged | +Inquiry |
| GGH-4871H | Recombinant Human GGH Protein, GST-tagged | +Inquiry |
| GGH-2518R | Recombinant Rat GGH Protein | +Inquiry |
| GGH-13241H | Recombinant Human GGH, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GGH-5948HCL | Recombinant Human GGH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GGH Products
Required fields are marked with *
My Review for All GGH Products
Required fields are marked with *
