Recombinant Human GGT1 protein, T7/His-tagged
| Cat.No. : | GGT1-55H |
| Product Overview : | Recombinant human CD224 cDNA (28-569aa, derived from BC025927) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Protein Length : | 28-569 a.a. |
| Form : | 0.4 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGESASKEPDNHVYTRAAVAADAKQCSKIGRDALRDGGSAVDAAIAALLC VGLMNAHSMGIGGGLFLTIYNSTTRKAEVINAREVAPRLAFATMFNSSEQSQKGGLSVAVPGEIRGYELAHQRHG RLPWARLFQPSIQLARQGFPVGKGLAAALENKRTVIEQQPVLCEVFCRDRKVLREGERLTLPQLADTYETLAIEG AQAFYNGSLTAQIVKDIQAAGGIVTAEDLNNYRAELIEHPLNISLGDVVLYMPSAPLSGPVLALILNILKGYNFS RESVESPEQKGLTYHRIVEAFRFAYAKRTLLGDPKFVDVTEVVRNMTSEFFAAQLRAQISDDTTHPISYYKPEFY TPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNNEMDDFSSPSITNEFGVPPSPANFIQPGKQP LSSMCPTIMVGQDGQVRMVVGAAGGTQITTATALAIIYNLWFGYDVKRAVEEPRLHNQLLPNVTTVERNIDQAVT AALETRHHHTQIASTFIAVVQAIVRTAGGWAAASDSRKGGEPAGY |
| Purity : | >90% by SDS-PAGE |
| Applications : | 1. May be used f in vitro human glutathione metabolism mediated apoptosis regulation study with this protein as coating or matrix protein.2. May be used for protein-protein interaction assay development.3. Potential biomarker protein for various cancer, such as endometrial cancer,4. As antigen for specific antibody production. |
| Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
| Gene Name | GGT1 gamma-glutamyltransferase 1 [ Homo sapiens ] |
| Official Symbol | GGT1 |
| Synonyms | GGT1; gamma-glutamyltransferase 1; GGT; gamma-glutamyltranspeptidase 1; CD224; D22S672; D22S732; glutamyl transpeptidase; glutathione hydrolase 1; gamma-glutamyl transpeptidase; GTG; GGT 1; MGC96892; MGC96904; MGC96963; |
| Gene ID | 2678 |
| mRNA Refseq | NM_001032364 |
| Protein Refseq | NP_001027536 |
| MIM | 612346 |
| UniProt ID | P19440 |
| Chromosome Location | 22q11.23 |
| Pathway | Arachidonic acid metabolism, organism-specific biosystem; Arachidonic acid metabolism, conserved biosystem; Biological oxidations, organism-specific biosystem; Cyanoamino acid metabolism, organism-specific biosystem; Cyanoamino acid metabolism, conserved biosystem; Eicosanoid Synthesis, organism-specific biosystem; Glutathione conjugation, organism-specific biosystem; |
| Function | gamma-glutamyltransferase activity; gamma-glutamyltransferase activity; hydrolase activity; protein binding; transferase activity, transferring acyl groups; |
| ◆ Recombinant Proteins | ||
| RFL14697SF | Recombinant Full Length Pig Gamma-Glutamyltranspeptidase 1(Ggt1) Protein, His-Tagged | +Inquiry |
| GGT1-1598H | Recombinant Human GGT1 protein, His-tagged | +Inquiry |
| GGT1-55H | Recombinant Human GGT1 protein, T7/His-tagged | +Inquiry |
| GGT1-196HF | Recombinant Full Length Human GGT1 Protein | +Inquiry |
| GGT1-2523R | Recombinant Rat GGT1 Protein | +Inquiry |
| ◆ Native Proteins | ||
| GGT1-5353H | Native Human Gamma-Glutamyltransferase 1 | +Inquiry |
| GGT1-371P | Native Porcine Gamma-Glutamyltransferase 1 | +Inquiry |
| GGT1-8131H | Native Human Liver Gamma Glutamyl Transpeptidase | +Inquiry |
| GGT1-8130H | Native Human Liver Gamma-Glutamyltransferase | +Inquiry |
| GGT1-667H | Native Human Gamma-Glutamyl Transferase 1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GGT1-1344RCL | Recombinant Rat GGT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GGT1 Products
Required fields are marked with *
My Review for All GGT1 Products
Required fields are marked with *
