Recombinant Human GGT1 protein, T7/His-tagged

Cat.No. : GGT1-55H
Product Overview : Recombinant human CD224 cDNA (28-569aa, derived from BC025927) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 28-569 a.a.
Form : 0.4 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGHHHHHHGNLYFQGGESASKEPDNHVYTRAAVAADAKQCSKIGRDALRDGGSAVDAAIAALLC VGLMNAHSMGIGGGLFLTIYNSTTRKAEVINAREVAPRLAFATMFNSSEQSQKGGLSVAVPGEIRGYELAHQRHG RLPWARLFQPSIQLARQGFPVGKGLAAALENKRTVIEQQPVLCEVFCRDRKVLREGERLTLPQLADTYETLAIEG AQAFYNGSLTAQIVKDIQAAGGIVTAEDLNNYRAELIEHPLNISLGDVVLYMPSAPLSGPVLALILNILKGYNFS RESVESPEQKGLTYHRIVEAFRFAYAKRTLLGDPKFVDVTEVVRNMTSEFFAAQLRAQISDDTTHPISYYKPEFY TPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNNEMDDFSSPSITNEFGVPPSPANFIQPGKQP LSSMCPTIMVGQDGQVRMVVGAAGGTQITTATALAIIYNLWFGYDVKRAVEEPRLHNQLLPNVTTVERNIDQAVT AALETRHHHTQIASTFIAVVQAIVRTAGGWAAASDSRKGGEPAGY
Purity : >90% by SDS-PAGE
Applications : 1. May be used f in vitro human glutathione metabolism mediated apoptosis regulation study with this protein as coating or matrix protein.2. May be used for protein-protein interaction assay development.3. Potential biomarker protein for various cancer, such as endometrial cancer,4. As antigen for specific antibody production.
Storage : Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name GGT1 gamma-glutamyltransferase 1 [ Homo sapiens ]
Official Symbol GGT1
Synonyms GGT1; gamma-glutamyltransferase 1; GGT; gamma-glutamyltranspeptidase 1; CD224; D22S672; D22S732; glutamyl transpeptidase; glutathione hydrolase 1; gamma-glutamyl transpeptidase; GTG; GGT 1; MGC96892; MGC96904; MGC96963;
Gene ID 2678
mRNA Refseq NM_001032364
Protein Refseq NP_001027536
MIM 612346
UniProt ID P19440
Chromosome Location 22q11.23
Pathway Arachidonic acid metabolism, organism-specific biosystem; Arachidonic acid metabolism, conserved biosystem; Biological oxidations, organism-specific biosystem; Cyanoamino acid metabolism, organism-specific biosystem; Cyanoamino acid metabolism, conserved biosystem; Eicosanoid Synthesis, organism-specific biosystem; Glutathione conjugation, organism-specific biosystem;
Function gamma-glutamyltransferase activity; gamma-glutamyltransferase activity; hydrolase activity; protein binding; transferase activity, transferring acyl groups;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GGT1 Products

Required fields are marked with *

My Review for All GGT1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon