Recombinant Human GHRL Protein, GST-tagged

Cat.No. : GHRL-4892H
Product Overview : Human GHRL full-length ORF ( AAH25791.1, 1 a.a. - 117 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes ghrelin-obestatin preproprotein, which generates ghrelin and obestatin. Ghrelin is an endogenous ligand for the growth hormone secretagogue receptor and is involved in regulating growth hormone release. Obestatin was initially reported to be an endogenous ligand for the orphan G protein-coupled receptor GPR39 and was involved in satiety and decreased food intake; however, these findings are controversial. Recent reports show that obestatin is involved in inhibiting thirst and anxiety, improving memory, regulating sleep, affecting cell proliferation, and increasing the secretion of pancreatic juice enzymes. Alternative promoters and alternative splicing result in multiple transcript variants, some of which encode different protein isoforms and some of which do not encode a protein but may regulate the ghrelin-obestatin preproprotein expression. In addition, antisense transcripts for this gene have been identified and may also function in regulation of the ghrelin-obestatin preproprotein expression. [provided by RefSeq
Molecular Mass : 38.61 kDa
AA Sequence : MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDEMEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GHRL ghrelin/obestatin prepropeptide [ Homo sapiens ]
Official Symbol GHRL
Synonyms GHRL; ghrelin/obestatin prepropeptide; ghrelin, growth hormone secretagogue receptor ligand; appetite-regulating hormone; ghrelin; MTLRP; obestatin; motilin-related peptide; growth hormone secretagogue; ghrelin/obestatin preprohormone; growth hormone-releasing peptide;
Gene ID 51738
mRNA Refseq NM_001134941
Protein Refseq NP_001128413
MIM 605353
UniProt ID Q9UBU3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GHRL Products

Required fields are marked with *

My Review for All GHRL Products

Required fields are marked with *

0
cart-icon
0
compare icon