Recombinant Human GIN1 Protein, GST-tagged
| Cat.No. : | GIN1-4907H | 
| Product Overview : | Human GIN1 full-length ORF ( AAH15325.1, 1 a.a. - 222 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | GIN1 (Gypsy Retrotransposon Integrase 1) is a Protein Coding gene. Diseases associated with GIN1 include Parametritis and Osmotic Diarrhea. GO annotations related to this gene include nucleic acid binding. | 
| Molecular Mass : | 52.1 kDa | 
| AA Sequence : | MVRSGKNGDLHLKQIAYYKRTCEYHSTTLPSERSGIRRAAKKFVFKEKKLFYVGKDRKQNRLVIVSEEEKKKVLRECHENDSGAHHGISRTLTLVESNYYWTSVTNDVKQWVYACQHCQVAKNTVIVAPKQHLLKVENPWSLVTVDLMGPFHTSNRSHVYAIIMTDLFTKWIVILPLCDVSASEVSKAIINIFFLYGPPQKIIMDQRDEFIQQKVFISCKVQ | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array  | 
                                
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | GIN1 gypsy retrotransposon integrase 1 [ Homo sapiens ] | 
| Official Symbol | GIN1 | 
| Synonyms | GIN1; gypsy retrotransposon integrase 1; ZH2C2, zinc finger, H2C2 domain containing; gypsy retrotransposon integrase-like protein 1; FLJ20125; GIN 1; gypsy integrase 1; TGIN1; Ty3/Gypsy integrase 1; zinc finger, H2C2 domain containing; zinc finger H2C2 domain-containing protein; GIN-1; ZH2C2; | 
| Gene ID | 54826 | 
| mRNA Refseq | NM_017676 | 
| Protein Refseq | NP_060146 | 
| UniProt ID | Q9NXP7 | 
| ◆ Recombinant Proteins | ||
| GIN1-5262HF | Recombinant Full Length Human GIN1 Protein, GST-tagged | +Inquiry | 
| GIN1-289C | Recombinant Cynomolgus Monkey GIN1 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| GIN1-544C | Recombinant Cynomolgus GIN1 Protein, His-tagged | +Inquiry | 
| GIN1-2538R | Recombinant Rat GIN1 Protein | +Inquiry | 
| GIN1-4907H | Recombinant Human GIN1 Protein, GST-tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All GIN1 Products
Required fields are marked with *
My Review for All GIN1 Products
Required fields are marked with *
  
        
    
      
            