Recombinant Human GIN1 Protein, GST-tagged
Cat.No. : | GIN1-4907H |
Product Overview : | Human GIN1 full-length ORF ( AAH15325.1, 1 a.a. - 222 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | GIN1 (Gypsy Retrotransposon Integrase 1) is a Protein Coding gene. Diseases associated with GIN1 include Parametritis and Osmotic Diarrhea. GO annotations related to this gene include nucleic acid binding. |
Molecular Mass : | 52.1 kDa |
AA Sequence : | MVRSGKNGDLHLKQIAYYKRTCEYHSTTLPSERSGIRRAAKKFVFKEKKLFYVGKDRKQNRLVIVSEEEKKKVLRECHENDSGAHHGISRTLTLVESNYYWTSVTNDVKQWVYACQHCQVAKNTVIVAPKQHLLKVENPWSLVTVDLMGPFHTSNRSHVYAIIMTDLFTKWIVILPLCDVSASEVSKAIINIFFLYGPPQKIIMDQRDEFIQQKVFISCKVQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GIN1 gypsy retrotransposon integrase 1 [ Homo sapiens ] |
Official Symbol | GIN1 |
Synonyms | GIN1; gypsy retrotransposon integrase 1; ZH2C2, zinc finger, H2C2 domain containing; gypsy retrotransposon integrase-like protein 1; FLJ20125; GIN 1; gypsy integrase 1; TGIN1; Ty3/Gypsy integrase 1; zinc finger, H2C2 domain containing; zinc finger H2C2 domain-containing protein; GIN-1; ZH2C2; |
Gene ID | 54826 |
mRNA Refseq | NM_017676 |
Protein Refseq | NP_060146 |
UniProt ID | Q9NXP7 |
◆ Recombinant Proteins | ||
GIN1-3559M | Recombinant Mouse GIN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GIN1-544C | Recombinant Cynomolgus GIN1 Protein, His-tagged | +Inquiry |
GIN1-5262HF | Recombinant Full Length Human GIN1 Protein, GST-tagged | +Inquiry |
GIN1-289C | Recombinant Cynomolgus Monkey GIN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GIN1-1851R | Recombinant Rhesus monkey GIN1 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GIN1 Products
Required fields are marked with *
My Review for All GIN1 Products
Required fields are marked with *
0
Inquiry Basket