Recombinant Human GIT2 protein, GST-tagged

Cat.No. : GIT2-3736H
Product Overview : Recombinant Human GIT2 protein, fused to GST tag, was expressed in E. coli.
Availability July 28, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : SSLSGSKDNVELILKTINNQHSVESQDNDQPDYDSVASDEDTDLETTASKTNRQKSLDSDLSDGPVTVQEFMEVKNALVAS
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name GIT2 G protein-coupled receptor kinase interacting ArfGAP 2 [ Homo sapiens ]
Official Symbol GIT2
Synonyms GIT2; G protein-coupled receptor kinase interacting ArfGAP 2; G protein coupled receptor kinase interactor 2; ARF GTPase-activating protein GIT2; KIAA0148; ARF GAP GIT2; GRK-interacting protein 2; G protein-coupled receptor kinase-interactor 2; cool-associated, tyrosine phosphorylated protein 2; cool-interacting tyrosine-phosphorylated protein 2; CAT2; CAT-2; MGC760; DKFZp686G01261;
Gene ID 9815
mRNA Refseq NM_001135213
Protein Refseq NP_001128685
MIM 608564
UniProt ID Q14161

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GIT2 Products

Required fields are marked with *

My Review for All GIT2 Products

Required fields are marked with *

0
cart-icon
0
compare icon