Recombinant Human GIT2 protein, GST-tagged
| Cat.No. : | GIT2-3736H |
| Product Overview : | Recombinant Human GIT2 protein, fused to GST tag, was expressed in E. coli. |
| Availability | January 30, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | SSLSGSKDNVELILKTINNQHSVESQDNDQPDYDSVASDEDTDLETTASKTNRQKSLDSDLSDGPVTVQEFMEVKNALVAS |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | GIT2 G protein-coupled receptor kinase interacting ArfGAP 2 [ Homo sapiens ] |
| Official Symbol | GIT2 |
| Synonyms | GIT2; G protein-coupled receptor kinase interacting ArfGAP 2; G protein coupled receptor kinase interactor 2; ARF GTPase-activating protein GIT2; KIAA0148; ARF GAP GIT2; GRK-interacting protein 2; G protein-coupled receptor kinase-interactor 2; cool-associated, tyrosine phosphorylated protein 2; cool-interacting tyrosine-phosphorylated protein 2; CAT2; CAT-2; MGC760; DKFZp686G01261; |
| Gene ID | 9815 |
| mRNA Refseq | NM_001135213 |
| Protein Refseq | NP_001128685 |
| MIM | 608564 |
| UniProt ID | Q14161 |
| ◆ Recombinant Proteins | ||
| GIT2-3736H | Recombinant Human GIT2 protein, GST-tagged | +Inquiry |
| GIT2-5780C | Recombinant Chicken GIT2 | +Inquiry |
| GIT2-874H | Recombinant Human GIT2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| GIT2-4917H | Recombinant Human GIT2 Protein, GST-tagged | +Inquiry |
| GIT2-1856R | Recombinant Rhesus monkey GIT2 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GIT2-5925HCL | Recombinant Human GIT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GIT2 Products
Required fields are marked with *
My Review for All GIT2 Products
Required fields are marked with *
