Recombinant Human GJA1 protein, His-tagged
| Cat.No. : | GJA1-350H |
| Product Overview : | Recombinant Human GJA1 protein(NP_000156.1)(Ser244~Ile382), fused to His-tag at N-terminus, was expressed in E. coli. |
| Availability | January 08, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Ser244~Ile382 |
| Description : | This gene is a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. The encoded protein is the major protein of gap junctions in the heart that are thought to have a crucial role in the synchronized contraction of the heart and in embryonic development. A related intronless pseudogene has been mapped to chromosome 5. Mutations in this gene have been associated with oculodentodigital dysplasia, autosomal recessive craniometaphyseal dysplasia and heart malformations. |
| Form : | 20mM Tris, 150mM NaCl, pH8.0, containing 1mM EDTA, 1mM DTT, 0.01% SKL, 5% Trehalose and Proclin300. |
| Molecular Mass : | 26kDa as determined by SDS-PAGE reducing conditions. |
| AA Sequence : | SDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI |
| Endotoxin : | <1.0EU per 1µg (determined by the LAL method) |
| Purity : | > 80% |
| Notes : | The kit is designed for research use only, we will not be responsible for any issue if the kit was used in clinical diagnostic or any other procedures. |
| Stability : | The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition. |
| Storage : | Avoid repeated freeze/thaw cycles. Store at 2-8°C for one month. Aliquot and store at -80ºC for 12 months. |
| Reconstitution : | Reconstitute in 20mM Tris, 150mM NaCl (pH8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex. |
| Publications : |
An autoantibody profile detects Brugada syndrome and identifies abnormally expressed myocardial proteins (2020)
|
| Gene Name | GJA1 gap junction protein alpha 1 [ Homo sapiens (human) ] |
| Official Symbol | GJA1 |
| Synonyms | HSS; CMDR; CX43; EKVP; GJAL; ODDD; AVSD3; EKVP3; HLHS1; PPKCA |
| Gene ID | 2697 |
| mRNA Refseq | NM_000165.5 |
| Protein Refseq | NP_000156.1 |
| MIM | 121014 |
| UniProt ID | P17302 |
| ◆ Recombinant Proteins | ||
| RFL33951MF | Recombinant Full Length Macaca Fascicularis Gap Junction Alpha-1 Protein(Gja1) Protein, His-Tagged | +Inquiry |
| GJA1-6368M | Recombinant Mouse GJA1 Protein | +Inquiry |
| GJA1-350H | Recombinant Human GJA1 protein, His-tagged | +Inquiry |
| Gja1-351M | Recombinant Mouse Gja1 Protein, His-tagged | +Inquiry |
| Gja1-2222M | Recombinant Mouse Gja1 protein, His&Myc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GJA1-5923HCL | Recombinant Human GJA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GJA1 Products
Required fields are marked with *
My Review for All GJA1 Products
Required fields are marked with *
