Recombinant Human GJA1 protein, His-tagged

Cat.No. : GJA1-2221H
Product Overview : Recombinant Human GJA1 protein(P17302)(233-382aa), fused to N-terminal His tag, was expressed in Insect Cell.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His
Protein Length : 233-382aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 18.8 kDa
AA Sequence : FKGVKDRVKGKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Gene Name GJA1 gap junction protein, alpha 1, 43kDa [ Homo sapiens ]
Official Symbol GJA1
Synonyms GJA1; gap junction protein, alpha 1, 43kDa; gap junction protein, alpha 1, 43kDa (connexin 43) , gap junction protein, alpha like , GJAL, ODDD; gap junction alpha-1 protein; connexin 43; CX43; oculodentodigital dysplasia (syndactyly type III); ODD; ODOD; SDTY3; connexin-43; gap junction 43 kDa heart protein; HSS; GJAL; ODDD; AVSD3; HLHS1; DFNB38;
Gene ID 2697
mRNA Refseq NM_000165
Protein Refseq NP_000156
MIM 121014
UniProt ID P17302

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GJA1 Products

Required fields are marked with *

My Review for All GJA1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon