Recombinant Human GJA1 protein, His-tagged
| Cat.No. : | GJA1-2221H |
| Product Overview : | Recombinant Human GJA1 protein(P17302)(233-382aa), fused to N-terminal His tag, was expressed in Insect Cell. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Insect Cells |
| Tag : | His |
| Protein Length : | 233-382aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 18.8 kDa |
| AA Sequence : | FKGVKDRVKGKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | GJA1 gap junction protein, alpha 1, 43kDa [ Homo sapiens ] |
| Official Symbol | GJA1 |
| Synonyms | GJA1; gap junction protein, alpha 1, 43kDa; gap junction protein, alpha 1, 43kDa (connexin 43) , gap junction protein, alpha like , GJAL, ODDD; gap junction alpha-1 protein; connexin 43; CX43; oculodentodigital dysplasia (syndactyly type III); ODD; ODOD; SDTY3; connexin-43; gap junction 43 kDa heart protein; HSS; GJAL; ODDD; AVSD3; HLHS1; DFNB38; |
| Gene ID | 2697 |
| mRNA Refseq | NM_000165 |
| Protein Refseq | NP_000156 |
| MIM | 121014 |
| UniProt ID | P17302 |
| ◆ Recombinant Proteins | ||
| RFL16814CF | Recombinant Full Length Dog Gap Junction Alpha-1 Protein(Gja1) Protein, His-Tagged | +Inquiry |
| GJA1-6368M | Recombinant Mouse GJA1 Protein | +Inquiry |
| Gja1-5414M | Recombinant Mouse Gja1 protein, His-Myc-tagged | +Inquiry |
| RFL23029MF | Recombinant Full Length Mouse Gap Junction Alpha-1 Protein(Gja1) Protein, His-Tagged | +Inquiry |
| Gja1-1310M | Recombinant Mouse Gja1 protein, His&Myc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GJA1-5923HCL | Recombinant Human GJA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GJA1 Products
Required fields are marked with *
My Review for All GJA1 Products
Required fields are marked with *
