Recombinant Human GJA1 protein, His-tagged

• Cat.No.: GJA1-2221H
• Product Overview: Recombinant Human GJA1 protein(P17302)(233-382aa), fused to N-terminal His tag, was expressed in Insect Cell.

Specification

• Species: Human
• Source: Insect Cells
• Tag: His
• Protein Length: 233-382aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 18.8 kDa
• AA Sequence: FKGVKDRVKGKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: GJA1 gap junction protein, alpha 1, 43kDa [ Homo sapiens ]
• Official Symbol: GJA1
• Synonyms: GJA1; gap junction protein, alpha 1, 43kDa; gap junction protein, alpha 1, 43kDa (connexin 43) , gap junction protein, alpha like , GJAL, ODDD; gap junction alpha-1 protein; connexin 43; CX43; oculodentodigital dysplasia (syndactyly type III); ODD; ODOD; SDTY3; connexin-43; gap junction 43 kDa heart protein; HSS; GJAL; ODDD; AVSD3; HLHS1; DFNB38
• Gene ID: 2697
• mRNA Refseq: NM_000165
• Protein Refseq: NP_000156
• MIM: 121014
• UniProt ID: P17302