Recombinant Human GJA4
| Cat.No. : | GJA4-26253TH | 
| Product Overview : | Recombinant full length protein Human Connexin 37 / GJA4 with a N terminal proprietary tag: predicted molecular weight 62.70 kDa inclusive of tag. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | Non | 
| Protein Length : | 333 amino acids | 
| Description : | This gene encodes a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. Mutations in this gene have been associated with atherosclerosis and a higher risk of myocardial infarction. | 
| Molecular Weight : | 62.700kDa inclusive of tags | 
| Tissue specificity : | Expressed in multiple organs and tissues, including heart, uterus, ovary, and blood vessel endothelium. | 
| Form : | Liquid | 
| Purity : | Proprietary Purification | 
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl | 
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. | 
| Sequences of amino acids : | MGDWGFLEKLLDQVQEHSTVVGKIWLTVLFIFRILILGLA GESVWGDEQSDFECNTAQPGCTNVCYDQAFPISHIRYWVL QFLFVSTPTLVYLGHVIYLSRREERLRQKEGELRALPAKD PQVERALAAVERQMAKISVAEDGRLRIRGALMGTYVASVL CKSVLEAGFLYGQWRLYGWTMEPVFVCQRAPCPYLVDCFV SRPTEKTIFIIFMLVVGLISLVLNLLELVHLLCRCLSRGM RARQGQDAPPTQGTSSDPYTDQVFFYLPVGQGPSSPPCPT YNGLSSSEQNWANLTTEERLASSRPPLFLDPPPQNGQKPP SRPSSSASKKQYV | 
| Sequence Similarities : | Belongs to the connexin family. Alpha-type (group II) subfamily. | 
| Gene Name | GJA4 gap junction protein, alpha 4, 37kDa [ Homo sapiens ] | 
| Official Symbol | GJA4 | 
| Synonyms | GJA4; gap junction protein, alpha 4, 37kDa; gap junction protein, alpha 4, 37kD (connexin 37) , gap junction protein, alpha 4, 37kDa (connexin 37); gap junction alpha-4 protein; connexin 37; CX37; | 
| Gene ID | 2701 | 
| mRNA Refseq | NM_002060 | 
| Protein Refseq | NP_002051 | 
| MIM | 121012 | 
| Uniprot ID | P35212 | 
| Chromosome Location | 1p35.1 | 
| Pathway | Calcium Regulation in the Cardiac Cell, organism-specific biosystem; Gap junction assembly, organism-specific biosystem; Gap junction trafficking, organism-specific biosystem; Gap junction trafficking and regulation, organism-specific biosystem; Membrane Trafficking, organism-specific biosystem; | 
| ◆ Recombinant Proteins | ||
| GJA4-2203R | Recombinant Rat GJA4 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| RFL29813XF | Recombinant Full Length Xenopus Tropicalis Gap Junction Alpha-4 Protein(Gja4) Protein, His-Tagged | +Inquiry | 
| GJA4-191HF | Recombinant Full Length Human GJA4 Protein | +Inquiry | 
| GJA4-6370M | Recombinant Mouse GJA4 Protein | +Inquiry | 
| GJA4-4922H | Recombinant Human GJA4 Protein, GST-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| GJA4-5922HCL | Recombinant Human GJA4 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GJA4 Products
Required fields are marked with *
My Review for All GJA4 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            