Recombinant Human GJA4
Cat.No. : | GJA4-26253TH |
Product Overview : | Recombinant full length protein Human Connexin 37 / GJA4 with a N terminal proprietary tag: predicted molecular weight 62.70 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 333 amino acids |
Description : | This gene encodes a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. Mutations in this gene have been associated with atherosclerosis and a higher risk of myocardial infarction. |
Molecular Weight : | 62.700kDa inclusive of tags |
Tissue specificity : | Expressed in multiple organs and tissues, including heart, uterus, ovary, and blood vessel endothelium. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MGDWGFLEKLLDQVQEHSTVVGKIWLTVLFIFRILILGLA GESVWGDEQSDFECNTAQPGCTNVCYDQAFPISHIRYWVL QFLFVSTPTLVYLGHVIYLSRREERLRQKEGELRALPAKD PQVERALAAVERQMAKISVAEDGRLRIRGALMGTYVASVL CKSVLEAGFLYGQWRLYGWTMEPVFVCQRAPCPYLVDCFV SRPTEKTIFIIFMLVVGLISLVLNLLELVHLLCRCLSRGM RARQGQDAPPTQGTSSDPYTDQVFFYLPVGQGPSSPPCPT YNGLSSSEQNWANLTTEERLASSRPPLFLDPPPQNGQKPP SRPSSSASKKQYV |
Sequence Similarities : | Belongs to the connexin family. Alpha-type (group II) subfamily. |
Gene Name | GJA4 gap junction protein, alpha 4, 37kDa [ Homo sapiens ] |
Official Symbol | GJA4 |
Synonyms | GJA4; gap junction protein, alpha 4, 37kDa; gap junction protein, alpha 4, 37kD (connexin 37) , gap junction protein, alpha 4, 37kDa (connexin 37); gap junction alpha-4 protein; connexin 37; CX37; |
Gene ID | 2701 |
mRNA Refseq | NM_002060 |
Protein Refseq | NP_002051 |
MIM | 121012 |
Uniprot ID | P35212 |
Chromosome Location | 1p35.1 |
Pathway | Calcium Regulation in the Cardiac Cell, organism-specific biosystem; Gap junction assembly, organism-specific biosystem; Gap junction trafficking, organism-specific biosystem; Gap junction trafficking and regulation, organism-specific biosystem; Membrane Trafficking, organism-specific biosystem; |
◆ Recombinant Proteins | ||
RFL29813XF | Recombinant Full Length Xenopus Tropicalis Gap Junction Alpha-4 Protein(Gja4) Protein, His-Tagged | +Inquiry |
RFL2986XF | Recombinant Full Length Xenopus Laevis Gap Junction Alpha-4 Protein(Gja4) Protein, His-Tagged | +Inquiry |
GJA4-6996H | Recombinant Human GJA4 protein, His-tagged | +Inquiry |
GJA4-2547R | Recombinant Rat GJA4 Protein | +Inquiry |
GJA4-4922H | Recombinant Human GJA4 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GJA4-5922HCL | Recombinant Human GJA4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GJA4 Products
Required fields are marked with *
My Review for All GJA4 Products
Required fields are marked with *