Recombinant Human GJB6 protein, His-tagged
Cat.No. : | GJB6-3543H |
Product Overview : | Recombinant Human GJB6 protein(182-261 aa), fused to His tag, was expressed in E. coli. |
Availability | September 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 182-261 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | ISRPTEKTVFTIFMISASVICMLLNVAELCYLLLKVCFRRSKRAQTQKNHPNHALKESKQNEMNELISDSGQNAITGFPS |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | GJB6 gap junction protein, beta 6, 30kDa [ Homo sapiens ] |
Official Symbol | GJB6 |
Synonyms | GJB6; gap junction protein, beta 6, 30kDa; DFNA3, ectodermal dysplasia 2, hidrotic (Clouston syndrome) , ED2, gap junction protein, beta 6 , gap junction protein, beta 6 (connexin 30); gap junction beta-6 protein; connexin 30; CX30; EDH; HED; connexin-30; gap junction protein, beta 6 (connexin 30); ectodermal dysplasia 2, hidrotic (Clouston syndrome); ED2; DFNA3; DFNA3B; DFNB1B; |
Gene ID | 10804 |
mRNA Refseq | NM_001110219 |
Protein Refseq | NP_001103689 |
MIM | 604418 |
UniProt ID | O95452 |
◆ Recombinant Proteins | ||
GJB6-3543H | Recombinant Human GJB6 protein, His-tagged | +Inquiry |
GJB6-4933H | Recombinant Human GJB6 Protein, GST-tagged | +Inquiry |
GJB6-6378M | Recombinant Mouse GJB6 Protein | +Inquiry |
RFL32271HF | Recombinant Full Length Human Gap Junction Beta-6 Protein(Gjb6) Protein, His-Tagged | +Inquiry |
GJB6-3576M | Recombinant Mouse GJB6 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GJB6 Products
Required fields are marked with *
My Review for All GJB6 Products
Required fields are marked with *