Recombinant Human GJB7 Protein, GST-tagged

Cat.No. : GJB7-4934H
Product Overview : Human GJB7 full-length ORF ( NP_940970.1, 1 a.a. - 223 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Connexins, such as GJB7, are involved in the formation of gap junctions, intercellular conduits that directly connect the cytoplasms of contacting cells. Each gap junction channel is formed by docking of 2 hemichannels, each of which contains 6 connexin subunits (Sohl et al., 2003 [PubMed 12881038]).[supplied by OMIM
Molecular Mass : 52.3 kDa
AA Sequence : MSWMFLRDLLSGVNKYSTGTGWIWLAVVFVFRLLVYMVAAEHVWKDEQKEFECNSRQPGCKNVCFDDFFPISQVRLWALQLIMVSTPSLLVVLHVAYHEGREKRHRKKLYVSPGTMDGGLWYAYLISLIVKTGFEIGFLVLFYKLYDGFSVPYLIKCDLKPCPNTVDCFISKPTEKTIFILFLVITSCLCIVLNFIELSFLVLKCFIKCCLQKYLKKPQVLSV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GJB7 gap junction protein beta 7 [ Homo sapiens (human) ]
Official Symbol GJB7
Synonyms GJB7; gap junction protein beta 7; gap junction beta-7 protein; connexin-25; gap junction protein, beta 7, 25kDa
Gene ID 375519
mRNA Refseq NM_198568
Protein Refseq NP_940970
MIM 611921
UniProt ID Q6PEY0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GJB7 Products

Required fields are marked with *

My Review for All GJB7 Products

Required fields are marked with *

0
cart-icon
0
compare icon