Recombinant Human GJB7 Protein, GST-tagged
| Cat.No. : | GJB7-4934H |
| Product Overview : | Human GJB7 full-length ORF ( NP_940970.1, 1 a.a. - 223 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Connexins, such as GJB7, are involved in the formation of gap junctions, intercellular conduits that directly connect the cytoplasms of contacting cells. Each gap junction channel is formed by docking of 2 hemichannels, each of which contains 6 connexin subunits (Sohl et al., 2003 [PubMed 12881038]).[supplied by OMIM |
| Molecular Mass : | 52.3 kDa |
| AA Sequence : | MSWMFLRDLLSGVNKYSTGTGWIWLAVVFVFRLLVYMVAAEHVWKDEQKEFECNSRQPGCKNVCFDDFFPISQVRLWALQLIMVSTPSLLVVLHVAYHEGREKRHRKKLYVSPGTMDGGLWYAYLISLIVKTGFEIGFLVLFYKLYDGFSVPYLIKCDLKPCPNTVDCFISKPTEKTIFILFLVITSCLCIVLNFIELSFLVLKCFIKCCLQKYLKKPQVLSV |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GJB7 gap junction protein beta 7 [ Homo sapiens (human) ] |
| Official Symbol | GJB7 |
| Synonyms | GJB7; gap junction protein beta 7; gap junction beta-7 protein; connexin-25; gap junction protein, beta 7, 25kDa |
| Gene ID | 375519 |
| mRNA Refseq | NM_198568 |
| Protein Refseq | NP_940970 |
| MIM | 611921 |
| UniProt ID | Q6PEY0 |
| ◆ Recombinant Proteins | ||
| RFL30334HF | Recombinant Full Length Human Gap Junction Beta-7 Protein(Gjb7) Protein, His-Tagged | +Inquiry |
| GJB7-5298HF | Recombinant Full Length Human GJB7 Protein, GST-tagged | +Inquiry |
| GJB7-4934H | Recombinant Human GJB7 Protein, GST-tagged | +Inquiry |
| GJB7-1104H | Recombinant Human GJB7 | +Inquiry |
| GJB7-3034H | Recombinant Human GJB7 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GJB7-5916HCL | Recombinant Human GJB7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GJB7 Products
Required fields are marked with *
My Review for All GJB7 Products
Required fields are marked with *
