Recombinant Human GKN1 protein, His&Myc-tagged
| Cat.No. : | GKN1-5363H |
| Product Overview : | Recombinant Human GKN1 protein(Q9NS71)(35-199aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 35-199aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 25.7 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | NYNINVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVLWIVDISFCGDTVEN |
| Gene Name | GKN1 gastrokine 1 [ Homo sapiens ] |
| Official Symbol | GKN1 |
| Synonyms | GKN1; gastrokine 1; gastrokine-1; AMP18; BRICD1; CA11; AMP-18; BRICHOS domain containing 1; 18 kDa antrum mucosa protein; FOV; foveolin; MGC70354; |
| Gene ID | 56287 |
| mRNA Refseq | NM_019617 |
| Protein Refseq | NP_062563 |
| MIM | 606402 |
| UniProt ID | Q9NS71 |
| ◆ Recombinant Proteins | ||
| GKN1-296H | Recombinant Human GKN1, His-tagged | +Inquiry |
| Gkn1-7830M | Recombinant Mouse Gkn1 protein, His-tagged | +Inquiry |
| GKN1-5305HF | Recombinant Full Length Human GKN1 Protein, GST-tagged | +Inquiry |
| GKN1-01H | Recombinant Human GKN1 Protein, His-tagged | +Inquiry |
| GKN1-5454H | Recombinant Human GKN1 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GKN1-001HCL | Recombinant Human GKN1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GKN1 Products
Required fields are marked with *
My Review for All GKN1 Products
Required fields are marked with *
