Recombinant Human GKN1 Protein, His-tagged

Cat.No. : GKN1-01H
Product Overview : Recombinant human GKN1 protein (1-199aa, 223aa), fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.
Availability July 02, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-199 a.a.
Description : The protein encoded by this gene is found to be down-regulated in human gastric cancer tissue as compared to normal gastric mucosa.
Form : Liquid
Molecular Mass : 24.5 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMGSHMLAYSSVHCFREDKMKFTIVFAGLLGVFLAPALANYNINVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVLWIVDISFCGDTVEN
Purity : > 85% by SDS-PAGE
Applications : SDS-PAGE
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.25 mg/mL (determined by Bradford assay)
Storage Buffer : 20mM Tris-HCl (pH 8.0) containing 0.1M NaCl, 10% glycerol, 1mM DTT
Gene Name GKN1 gastrokine 1 [ Homo sapiens (human) ]
Official Symbol GKN1
Synonyms GKN1; gastrokine 1; FOV; CA11; AMP18; BRICD1; foveolin; gastrokine-1; 18 kDa antrum mucosa protein; BRICHOS domain containing 1
Gene ID 56287
mRNA Refseq NM_019617
Protein Refseq NP_062563
MIM 606402
UniProt ID Q9NS71

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GKN1 Products

Required fields are marked with *

My Review for All GKN1 Products

Required fields are marked with *

0
cart-icon