Recombinant Human GKN1 Protein, His-tagged
| Cat.No. : | GKN1-01H |
| Product Overview : | Recombinant human GKN1 protein (1-199aa, 223aa), fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques. |
| Availability | November 30, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-199 a.a. |
| Description : | The protein encoded by this gene is found to be down-regulated in human gastric cancer tissue as compared to normal gastric mucosa. |
| Form : | Liquid |
| Molecular Mass : | 24.5 kDa |
| AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSHMLAYSSVHCFREDKMKFTIVFAGLLGVFLAPALANYNINVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVLWIVDISFCGDTVEN |
| Purity : | > 85% by SDS-PAGE |
| Applications : | SDS-PAGE |
| Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
| Concentration : | 0.25 mg/mL (determined by Bradford assay) |
| Storage Buffer : | 20mM Tris-HCl (pH 8.0) containing 0.1M NaCl, 10% glycerol, 1mM DTT |
| Gene Name | GKN1 gastrokine 1 [ Homo sapiens (human) ] |
| Official Symbol | GKN1 |
| Synonyms | GKN1; gastrokine 1; FOV; CA11; AMP18; BRICD1; foveolin; gastrokine-1; 18 kDa antrum mucosa protein; BRICHOS domain containing 1 |
| Gene ID | 56287 |
| mRNA Refseq | NM_019617 |
| Protein Refseq | NP_062563 |
| MIM | 606402 |
| UniProt ID | Q9NS71 |
| ◆ Recombinant Proteins | ||
| GKN1-5643H | Recombinant Human GKN1 protein, His-tagged | +Inquiry |
| GKN1-7829H | Recombinant Human GKN1 protein, His & GST-tagged | +Inquiry |
| GKN1-296H | Recombinant Human GKN1, His-tagged | +Inquiry |
| Gkn1-7830M | Recombinant Mouse Gkn1 protein, His-tagged | +Inquiry |
| GKN1-4942H | Recombinant Human GKN1 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GKN1-001HCL | Recombinant Human GKN1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GKN1 Products
Required fields are marked with *
My Review for All GKN1 Products
Required fields are marked with *
